[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56520.1
DDBJ      :             tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
Swiss-Prot:MNMA_STRZP   RecName: Full=tRNA-specific 2-thiouridylase mnmA;         EC=2.8.1.-;

Homologs  Archaea  0/68 : Bacteria  897/915 : Eukaryota  129/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:373 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->373 2hmaA PDBj e-176 98.0 %
:RPS:PDB   22->365 2detA PDBj e-106 55.7 %
:RPS:SCOP  22->240 1xngA1  c.26.2.1 * 5e-32 18.1 %
:HMM:SCOP  5->245 2c5sA1 c.26.2.6 * 3.2e-62 41.4 %
:RPS:PFM   23->360 PF03054 * tRNA_Me_trans e-122 64.5 %
:HMM:PFM   8->360 PF03054 * tRNA_Me_trans 8.8e-149 55.9 349/356  
:BLT:SWISS 1->373 MNMA_STRZP 0.0 99.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56520.1 GT:GENE ACF56520.1 GT:PRODUCT tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 125893..127014 GB:FROM 125893 GB:TO 127014 GB:DIRECTION + GB:PRODUCT tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase GB:NOTE identified by match to protein family HMM PF03054; match to protein family HMM TIGR00420 GB:PROTEIN_ID ACF56520.1 GB:DB_XREF GI:194358072 LENGTH 373 SQ:AASEQ MSDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGIPYYSVNFEKEYWDRVFEYXXAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTLGADYVATGHYARVARDEDGTVHMLRGVDNGKDQTYFLSQLSQEQLQKTMFPLGHLEKPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLPAQPGRMMTVDGRDMGEHAGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQVHFTREMPEEFTLECTAKFRYRQPDSKVTVHVKGDKAEVIFAEPQRAITPGQAVVFYDGEECLGGGLIDNAYRDGQVCQYI GT:EXON 1|1-373:0| SW:ID MNMA_STRZP SW:DE RecName: Full=tRNA-specific 2-thiouridylase mnmA; EC=2.8.1.-; SW:GN Name=mnmA; OrderedLocusNames=SPP_0186; SW:KW ATP-binding; Complete proteome; Cytoplasm; Disulfide bond;Nucleotide-binding; RNA-binding; Transferase; tRNA processing;tRNA-binding. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->373|MNMA_STRZP|0.0|99.5|373/373| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| SEG 9->21|vvvgmsggvdssv| SEG 241->255|igqrgglgiggqhgg| BL:PDB:NREP 1 BL:PDB:REP 2->373|2hmaA|e-176|98.0|353/353| RP:PDB:NREP 1 RP:PDB:REP 22->365|2detA|e-106|55.7|343/365| RP:PFM:NREP 1 RP:PFM:REP 23->360|PF03054|e-122|64.5|330/348|tRNA_Me_trans| HM:PFM:NREP 1 HM:PFM:REP 8->360|PF03054|8.8e-149|55.9|349/356|tRNA_Me_trans| RP:SCP:NREP 1 RP:SCP:REP 22->240|1xngA1|5e-32|18.1|182/255|c.26.2.1| HM:SCP:REP 5->245|2c5sA1|3.2e-62|41.4|210/0|c.26.2.6|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 1140 OP:NHOMOORG 1026 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111-------111111111133331111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111121111111111111111111111111111111---1111111111111111111111111111111111111111111111111111222222212111111111121111111111111111112221122121111111111111111111111111111111111-111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111212111111111111212111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111-111111-11111111111111111111111111111111 ----111-311---1-----------------------------------------------11111111111111111111111111-111-11111111-1111-22122111121111-1112-318B1-3121111311111111-11-2121121--1311-114A11-22112I222223121-11222121- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 371 STR:RPRED 99.5 SQ:SECSTR #ccGGGcEEEEEccccHHHH#HHHHHHHHccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHTcccccccTHHHHHHHTHHHHHHHHHTTccccTHHHHHHHTTTTHHHHHHHTccccEEEcccccEEHEEETTEEEEEccccGGGccGGGGGcccTHHHHHEEccGGGccHHHHHHHHHHHTcTTcccccccccTTcccccHHHHHTTTccccccccccTTccccccccccTTccTTcccccccccccccccccEEEEEccTTTTccEEEEcTTcGGGEEEEEEEEccccTTccccccEEEEEEEccTTcccEEEEEEcccccEEEEEEEEEETccTTcEEEEEETTEEEEEEEEEEEEEcccccTTc DISOP:02AL 1-4| PSIPRED cccccccEEEEEEcccHHHHHHHHHHHHccccEEEEEEEccccccccccccHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHccccHHHHHccccccccccccHHHHHHHHHHHHHHccccEEEEEEEEEEEEcccccEEEEEEcccccccEEEEccccHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHccccccEEEcccccEEEEEccEEEEEcccccccccccccccccccEEEEEEEccccEEEEEEccccHHHHccEEEEEEEEEcccccccccEEEEEEEEEcccccEEEEEEEccEEEEEEccccccccccEEEEEEEccEEEEEEEEEEEEEcccEEccc //