[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56525.1
DDBJ      :             peptidase, M20/M25/M40 family
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  378/915 : Eukaryota  167/199 : Viruses  0/175   --->[See Alignment]
c.56.5
:457 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->457 2pokA PDBj 0.0 99.6 %
:RPS:PDB   8->456 3dljB PDBj 5e-39 24.8 %
:RPS:SCOP  24->182 1vgyA1  c.56.5.4 * 7e-29 24.7 %
:HMM:SCOP  6->456 1lfwA1 c.56.5.4 * 7.1e-48 29.7 %
:RPS:PFM   90->161 PF01546 * Peptidase_M20 3e-10 36.6 %
:RPS:PFM   285->353 PF07687 * M20_dimer 1e-07 40.6 %
:HMM:PFM   86->454 PF01546 * Peptidase_M20 9.2e-30 29.5 146/171  
:BLT:SWISS 67->442 CNDP1_RAT 5e-40 28.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56525.1 GT:GENE ACF56525.1 GT:PRODUCT peptidase, M20/M25/M40 family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 153472..154845 GB:FROM 153472 GB:TO 154845 GB:DIRECTION + GB:PRODUCT peptidase, M20/M25/M40 family GB:NOTE identified by match to protein family HMM PF01546; match to protein family HMM PF07687 GB:PROTEIN_ID ACF56525.1 GB:DB_XREF GI:194358077 LENGTH 457 SQ:AASEQ MVFPSEQEQIEKFEKDHVAQHYFEVLRTLISKKSVFAQQVGLKEVANYLGEIFKRVGAEVEIDESYTAPFVMAHFKSSRPDAKTLIFYNHYDTVPADGDQVWTEDPFTLSVRNGFMYGRGVDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEESASTDLDKYLEKHADKLRGADLLVWEQGTKNALEQLEISGGNKGIVTFDAKVKSADVDIHSSYGGVVESAPWYLLQALQSLRAADGRILVEGLYEEVQEPNEREMALLETYGQRNPEEVSRIYGLELPLLQEERMAFLKRFFFDPALNIEGIQSGYQGQGVKTILPAEASAKLEVRLVPGLEPHDVLEKIRKQLDKNGFDKVELYYTLGEMSYRSDMSAPAILNVIELAKKXYPQGVSVLPTTAGTGPMHTVFDALEVPMVAFGXGNANSRDHGGDENVRIADYYTHIELVEELIRSYE GT:EXON 1|1-457:0| BL:SWS:NREP 1 BL:SWS:REP 67->442|CNDP1_RAT|5e-40|28.6|360/492| BL:PDB:NREP 1 BL:PDB:REP 1->457|2pokA|0.0|99.6|457/458| RP:PDB:NREP 1 RP:PDB:REP 8->456|3dljB|5e-39|24.8|444/467| RP:PFM:NREP 2 RP:PFM:REP 90->161|PF01546|3e-10|36.6|71/308|Peptidase_M20| RP:PFM:REP 285->353|PF07687|1e-07|40.6|64/109|M20_dimer| HM:PFM:NREP 1 HM:PFM:REP 86->454|PF01546|9.2e-30|29.5|146/171|Peptidase_M20| GO:PFM:NREP 4 GO:PFM GO:0008152|"GO:metabolic process"|PF01546|IPR002933| GO:PFM GO:0016787|"GO:hydrolase activity"|PF01546|IPR002933| GO:PFM GO:0005515|"GO:protein binding"|PF07687|IPR011650| GO:PFM GO:0016787|"GO:hydrolase activity"|PF07687|IPR011650| RP:SCP:NREP 1 RP:SCP:REP 24->182|1vgyA1|7e-29|24.7|150/262|c.56.5.4| HM:SCP:REP 6->456|1lfwA1|7.1e-48|29.7|259/0|c.56.5.4|1/1|Zn-dependent exopeptidases| OP:NHOMO 927 OP:NHOMOORG 563 OP:PATTERN ------1311211112--------------1----1-------1----1--------1---1----11 12313111111111111----1--1------11111121111---121111122111111211111123311111111-1--1-----1111-1111--11111211111-------11111111-----------34444---21-------------------------------------31222---1-----------------21---------131--------21----------------------1-21---------21---112111111111111111111111111-------------21133-1111--------------------1111----2-----------1---------1-1-11-11111112331111111122222222222-2221221212--322421233322211--1411111221--------2111---------------11-11-111111111--1--111-111-23222231111-33432222-1212----1111-11211213-3211--1-----------11-----11--1----------------1-111121-1----------------------------1-1-12-111---------11-----------11-11-11111153-1----------------------------------33111----------------1-------1-111111111111--11-----22221---3----1---------------------------11--1-11-1-1---------1----11111111--1----------1-1-11-------------------------------------------1----------11 ----122-832-1122222222322232222221333333333222332222322222222232222212222222212221122211-24222232222212342-1--22722141122112331414U2-344-12222123-22--211443333112-1111111-221-222------21--12--11----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 457 STR:RPRED 100.0 SQ:SECSTR ccccTTHHHHHHHHHHTHHHHHHHHHHHHHTcccccccccHHHHHHHHHHHHHHHTTcEEEEEccEEcccEEEEEEcccTTccEEEEEEEcccccccGGGTccccTTccEEETTEEEcTTTTTTHHHHHHHHHHHHHHHHTTcccccEEEEEEEccGGGTcTTHHHHHHHTTTTTTTTTccEEEEcccccccccEEEEEEcEEEEEEEEEEcccccEETTTTTccccHHHHHHHHHTTcccTTcccccTTTTTTcccccHHHHHHHHTcccccHHHHHHHHTccccccccHHHHHHHHHTccEEEEEEEEEccccccccccEEccEEEEEEEEEEcTTccHHHHHHHHHHHHHHTcccEEEEEEEEEEccEEcccccGGGHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHcccEEEcccccTTccTTcTTcEEEHHHHHHHHHHHHHHHHHHH DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccccEEEEEEccccccccEEEEEEEcccccccccccccccccEEEEEccEEEEccccccHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccHHHHHHHHHHHHccccEEEEEccccccccccEEEEEcccEEEEEEEEEEEcccccccccccccccHHHHHHHHHHHHHcccccEEccccccccccccHHHHHHHHHHccccHHHHHHHHccHHHcccccccHHHHHHcccccEEEEEEEEcccccccccEEccEEEEEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEEccccccccccccHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHccccEEEEcccccccccccccccEEHHHHHHHHHHHHHHHHHcc //