[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56530.1
DDBJ      :             Dihydrodipicolinate synthetase family
Swiss-Prot:             

Homologs  Archaea  60/68 : Bacteria  818/915 : Eukaryota  124/199 : Viruses  0/175   --->[See Alignment]
c.1.10
:305 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->301 1hl2A PDBj 3e-43 32.0 %
:RPS:PDB   3->293 3cprA PDBj 5e-59 21.8 %
:RPS:SCOP  1->293 1f5zA  c.1.10.1 * 8e-64 28.1 %
:HMM:SCOP  6->295 1dhpA_ c.1.10.1 * 1.1e-70 34.9 %
:RPS:PFM   8->284 PF00701 * DHDPS 1e-43 35.2 %
:HMM:PFM   7->288 PF00701 * DHDPS 1.2e-55 30.2 278/289  
:BLT:SWISS 5->301 NANA_SHISS 2e-43 32.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56530.1 GT:GENE ACF56530.1 GT:PRODUCT Dihydrodipicolinate synthetase family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1187279..1188196) GB:FROM 1187279 GB:TO 1188196 GB:DIRECTION - GB:PRODUCT Dihydrodipicolinate synthetase family GB:NOTE identified by match to protein family HMM PF00701 GB:PROTEIN_ID ACF56530.1 GB:DB_XREF GI:194358082 LENGTH 305 SQ:AASEQ MKDLTKYKGVIPAFYACYDENGEISQDRVKSLVQYFIDKGVKGIYVNGSSGECIYQSVEDRKQIIEAVMEVAKGKLTVINHIACNNTKDSIELAKHSESVGVDAIAAIPPIYFKLPEYSIAAYWNAMSEAASNTDFIIYNIPQLAGVALTGSLYATMRQNPRVIGVKNSSMPVQDIQMFVAAGGEDYIVFNGPDEQYLGGRLMGAEAGIGGTYGVMPDLFLKLESLIQERDLDTAKKLQYAINEVIYKMISGKANMYAVAKEVLRLNEKLDLGSVRQPLEALAEGDLEVAKQAAELIQQARKEFL GT:EXON 1|1-305:0| BL:SWS:NREP 1 BL:SWS:REP 5->301|NANA_SHISS|2e-43|32.3|294/297| BL:PDB:NREP 1 BL:PDB:REP 5->301|1hl2A|3e-43|32.0|294/295| RP:PDB:NREP 1 RP:PDB:REP 3->293|3cprA|5e-59|21.8|284/301| RP:PFM:NREP 1 RP:PFM:REP 8->284|PF00701|1e-43|35.2|273/288|DHDPS| HM:PFM:NREP 1 HM:PFM:REP 7->288|PF00701|1.2e-55|30.2|278/289|DHDPS| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00701|IPR002220| GO:PFM GO:0016829|"GO:lyase activity"|PF00701|IPR002220| RP:SCP:NREP 1 RP:SCP:REP 1->293|1f5zA|8e-64|28.1|285/293|c.1.10.1| HM:SCP:REP 6->295|1dhpA_|1.1e-70|34.9|284/0|c.1.10.1|1/1|Aldolase| OP:NHOMO 1790 OP:NHOMOORG 1002 OP:PATTERN 111---224444444221121111111-21111111111111111111111111111-1122222--- 226-122122212122211-151122111112445412751-111121111-1111-2--11111134421111131122212111113423121111112111111315--------------1111111111-111111111-1-111--1111111111-1111111-1111111111112--111112112222222222222225233312221332211111111231222222222222222112211--11-1-1-33111212-1111111111111211333333332331111111111111211111111212124111111121235111222111--113112211111-222112111113111111111115451113332122222222223-112115112311833358587843422121222122112111111111121111311-111111---1111111111111----2111112211255525423332223333332441611321124111211234143121121111111111111111111-11111211111111111111111-13111111212211211-11111111111111222-11111112111111211112132122---111111111142323314224443422-2242233222254223222142432243232323333323223322222221122222222222211111111112111132322222222222222244243211211144342422123311111---------122222222212122112222222211111112111111----------1--------1--------1---1---1111112111112 ------1--------1-44233354421111111-11-1--1122211328798433-1111--3-------311--------------12---1--111---3-1--3-51122151-1112-2214-9B2-536222-2-121-211-2-131322322214311-121--31111--1--113---2-11241122 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 305 STR:RPRED 100.0 SQ:SECSTR cHTHHHHccEEEEccccccTTccccHHHHHHHHHHHHHTTccEEEEccTTTTTTTccHHHHHHHHHHHHHHHTTTcEEEEEcccccHHHHHHHHHHHHHTTccEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEcHHHHcccccHHHHHHHTTcTTEEEEEccccHHHHHHHHHHHHHHccEEEEccGGGHHHHHHTTccEEEEcGGGTcHHHHHHHHHHHHHTcHHHHHHHHHHTHHHHHHHHHHHcHHHHHHHHHHHHTcTcccccccTTcccccHHHHHHHHHHTTccccccHHHc DISOP:02AL 1-4| PSIPRED cccccccEEEEEEEcccccccccccHHHHHHHHHHHHHccccEEEEccccccHHHccHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHcccccEEEEEccccccccccHHHHHHHHccccEEEEEEccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHcccEEEcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHcc //