[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56534.1
DDBJ      :             small conductance mechanosensitive ion channel (MscS) family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  177/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.38.1f.34.1
:186 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  115->183 2oauA1  b.38.1.3 * 3e-11 33.8 %
:HMM:SCOP  21->114 2oauA3 f.34.1.1 * 2.8e-16 32.6 %
:HMM:SCOP  115->183 2oauA1 b.38.1.3 * 1.7e-11 40.0 %
:RPS:PFM   87->185 PF00924 * MS_channel 2e-07 33.7 %
:HMM:PFM   73->184 PF00924 * MS_channel 8.3e-32 31.5 108/207  
:HMM:PFM   15->92 PF06011 * TRP 2.2e-05 25.7 74/575  
:BLT:SWISS 8->184 YKUT_BACSU 2e-24 42.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56534.1 GT:GENE ACF56534.1 GT:PRODUCT small conductance mechanosensitive ion channel (MscS) family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1603943..1604503) GB:FROM 1603943 GB:TO 1604503 GB:DIRECTION - GB:PRODUCT small conductance mechanosensitive ion channel (MscS) family protein GB:NOTE identified by match to protein family HMM PF00924 GB:PROTEIN_ID ACF56534.1 GB:DB_XREF GI:194358086 LENGTH 186 SQ:AASEQ MQKFIQAYIEKLDVTXIIENILTKVISLLLLLIVFYIAKKMLHTMVQRIVKPSLKMSRHDVGRQKTISRLLENVFNYTLYFFLLYCILSILGLPVSSLLAGAGIAGVAIGMGAQGFLSDVINGFFILFERQLDVGDEVVLTNGPITVSGKVVSVGIRTTQLRSEEQALHFVPNRNITVVSNFSRTD GT:EXON 1|1-186:0| BL:SWS:NREP 1 BL:SWS:REP 8->184|YKUT_BACSU|2e-24|42.8|173/267| TM:NTM 2 TM:REGION 17->38| TM:REGION 82->104| SEG 28->32|lllll| SEG 95->113|vssllagagiagvaigmga| RP:PFM:NREP 1 RP:PFM:REP 87->185|PF00924|2e-07|33.7|95/203|MS_channel| HM:PFM:NREP 2 HM:PFM:REP 73->184|PF00924|8.3e-32|31.5|108/207|MS_channel| HM:PFM:REP 15->92|PF06011|2.2e-05|25.7|74/575|TRP| GO:PFM:NREP 2 GO:PFM GO:0016020|"GO:membrane"|PF00924|IPR006685| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00924|IPR006685| RP:SCP:NREP 1 RP:SCP:REP 115->183|2oauA1|3e-11|33.8|65/67|b.38.1.3| HM:SCP:REP 21->114|2oauA3|2.8e-16|32.6|86/0|f.34.1.1|1/1|Mechanosensitive channel protein MscS (YggB), transmembrane region| HM:SCP:REP 115->183|2oauA1|1.7e-11|40.0|65/0|b.38.1.3|1/1|Sm-like ribonucleoproteins| OP:NHOMO 180 OP:NHOMOORG 177 OP:PATTERN -------------------------------------------------------------------- -1---------1----------------------------------------------------------------------1--------------------------------------------------------------1-------------------11------------------1-----11111111111111111111--11111111111111111111111111111111111122211111111111-111111111--11111111111111111111111111111111111111111111111111-111111111111-----111-1--1---11--1-1-11111111-------------------------------------------------------------------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--1---111----------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,184-187| PSIPRED cHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccEEEEEEEEEEEEEEEEEEEEccccEEEEEcccEEEEEEccccc //