[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56542.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:188 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   49->92 PF03606 * DcuC 1.4e-05 22.7 44/463  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56542.1 GT:GENE ACF56542.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1628579..1629145 GB:FROM 1628579 GB:TO 1629145 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56542.1 GB:DB_XREF GI:194358094 LENGTH 188 SQ:AASEQ MSKAKKICFIIFCILILTIFLPVLIDYHQVSDLGIHLLSWRQNSVVEFYLARYVFWGTVVLSTLVLLSILVVMFYPKRYLEIQLETKNDTLKLKNSAIEGFVRSLVSDHRLIKNPTVHVNLRKNKCFVHVEGKILPSDNIADRCQIIQNEITNGLKQFFGIERQVKLEVAVKNYQPKPQNKKTVSRVK GT:EXON 1|1-188:0| TM:NTM 2 TM:REGION 11->33| TM:REGION 54->76| SEG 7->21|icfiifcililtifl| SEG 58->72|tvvlstlvllsilvv| HM:PFM:NREP 1 HM:PFM:REP 49->92|PF03606|1.4e-05|22.7|44/463|DcuC| OP:NHOMO 42 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21211111111--1111111111111111111111111--111---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,173-189| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcccEEEEEHHHccHHHHHHHHcccccccHHHHHHHHHHHHHccccccEEEEEEEccccEEEEEHHHHHHHHHHHHHHcccccccEEEEEEEEccEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccccccccccHHccc //