[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56543.1
DDBJ      :             ABC transporter, ATP-binding/permease protein
Swiss-Prot:             

Homologs  Archaea  35/68 : Bacteria  558/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:288 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->254 2r6gF PDBj 1e-10 27.8 %
:RPS:PDB   179->217 3dhwA PDBj 9e-09 35.9 %
:RPS:SCOP  55->259 2r6gF2  f.58.1.1 * 7e-18 22.4 %
:RPS:PFM   83->251 PF00528 * BPD_transp_1 3e-09 35.9 %
:HMM:PFM   83->286 PF00528 * BPD_transp_1 8e-21 26.4 182/185  
:HMM:PFM   4->35 PF00689 * Cation_ATPase_C 0.00096 28.1 32/183  
:BLT:SWISS 1->288 MSMF_STRMU e-117 71.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56543.1 GT:GENE ACF56543.1 GT:PRODUCT ABC transporter, ATP-binding/permease protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1718908..1719774) GB:FROM 1718908 GB:TO 1719774 GB:DIRECTION - GB:PRODUCT ABC transporter, ATP-binding/permease protein GB:NOTE identified by match to protein family HMM PF00528 GB:PROTEIN_ID ACF56543.1 GB:DB_XREF GI:194358095 LENGTH 288 SQ:AASEQ MKKVLQKYWAWAFVVIPLLLQAIFFYVPMFQGAFYSFTNWTGLTYNYKFVGLNNFKLLFMDPKFMNAIGFTAIITIAMVVGEIALGIFIARVLNSKIKGQTFFRAWFFFPAVLSGLTVALIFKQVFNYGLPAIGNALHIEFLQTSLLGTKWGAIFAAAFVLLWQGVAMPIIIFLAGLQSIPTEITEAARIDGATSKQVFWNIELPYLLPSVSMVFILALKGGLTAFDQVFAMTGGGPNNATTSLGLLVYNYAFKNNQFGYANAIAVILFLLIVVISIIQLRVSKKFEI GT:EXON 1|1-288:0| BL:SWS:NREP 1 BL:SWS:REP 1->288|MSMF_STRMU|e-117|71.5|288/290| TM:NTM 6 TM:REGION 8->30| TM:REGION 70->92| TM:REGION 101->123| TM:REGION 156->178| TM:REGION 206->228| TM:REGION 261->283| SEG 264->282|iavilfllivvisiiqlrv| BL:PDB:NREP 1 BL:PDB:REP 26->254|2r6gF|1e-10|27.8|223/490| RP:PDB:NREP 1 RP:PDB:REP 179->217|3dhwA|9e-09|35.9|39/203| RP:PFM:NREP 1 RP:PFM:REP 83->251|PF00528|3e-09|35.9|156/195|BPD_transp_1| HM:PFM:NREP 2 HM:PFM:REP 83->286|PF00528|8e-21|26.4|182/185|BPD_transp_1| HM:PFM:REP 4->35|PF00689|0.00096|28.1|32/183|Cation_ATPase_C| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 55->259|2r6gF2|7e-18|22.4|205/244|f.58.1.1| OP:NHOMO 3061 OP:NHOMOORG 597 OP:PATTERN 111-4-11343333426-1211--71151-3-----------------------1442111331---- ---1l213334-1113323-323349333334245413465234M*X2BHG4PKN-2A--868AJ3COXI6A666GC91---3-------------------------1---------------------------89977---66221311-11222212222221333--2-----1----ED154DF-953222222331132223PG664722354B18457897879*111111111111111-2---531-23--12133--22---1-42432323333322666778766663222233332222355---5553C4-3A1111121614B2--1333c-26223D--231--1I--1886E2-1-------111112-EAB1--535536766677777E---6--4-19P--YVVJbXQnkfVR11---9E98668C75--------4112--12-----------------------------2---2-1433368877651333448A4443336562222--2237-23342568D----1--3--------------1-2---1----1111---------222223----------1------------------116-----1-6----------------------1---------14861412222222222-222222232222122222135366--112111111111111114-212222--477777777777---------11111-85D111--1--------1------------22222233322233534-----------222222223154411111111111111-------------------161111---1-121-111----21---7LEB9AQ9DB-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------1--1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 245 STR:RPRED 85.1 SQ:SECSTR ###HHHHHHHHccHHHHHHHHHHHTEEEETTTTEEEEcccccEcccccccTTTTTcGGGTcTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccTTHHHHHHHTTHHHHccHHHHHHHHHHHTcccccHHHHHH######HHTccccTTTcHHHHHHHHHHHHHHHHHHHHHHGGHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTcHHHHHHHcccccccccccccccHHHHHHH################################## DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //