[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56547.1
DDBJ      :             phospho-N-acetylmuramoyl-pentapeptide- transferase
Swiss-Prot:MRAY_STRP4   RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;         EC=2.7.8.13;AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase;

Homologs  Archaea  18/68 : Bacteria  866/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
:326 amino acids
:PSIPRED
:RPS:PFM   81->240 PF00953 * Glycos_transf_4 1e-20 47.0 %
:HMM:PFM   81->242 PF00953 * Glycos_transf_4 2.9e-41 40.3 154/159  
:HMM:PFM   46->58 PF10555 * MraY_sig1 4.8e-08 61.5 13/13  
:BLT:SWISS 1->312 MRAY_STRP4 e-169 100.0 %
:PROS 46->58|PS01347|MRAY_1
:PROS 162->173|PS01348|MRAY_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56547.1 GT:GENE ACF56547.1 GT:PRODUCT phospho-N-acetylmuramoyl-pentapeptide- transferase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 294892..295872 GB:FROM 294892 GB:TO 295872 GB:DIRECTION + GB:PRODUCT phospho-N-acetylmuramoyl-pentapeptide- transferase GB:NOTE identified by match to protein family HMM PF00953; match to protein family HMM TIGR00445 GB:PROTEIN_ID ACF56547.1 GB:DB_XREF GI:194358099 LENGTH 326 SQ:AASEQ MFISISAGIVTFLLTLVGIPAFIQFYRKAQITGQQMHEDVKQHQAKAGTPTMGGLVFLIASVLVAFFFALFSNQLSNNVGMILFILVLYGLIGFLDDFLKVFRKINEGLNPKQKLALQLLGGVIFYLFYERGGDILSVFGYPVHLGFFYIFFALFWLVGFSNAVNLTDGVDGLASISVVISLSAYGVIAYVQGQMDILLVILAMIGGLLGFFIFNHKPAKVFMGDVGSLALGGMLAAISMALHQEWTLLIIGIVYVFETTSVMMQVSYFKLTGGKRIFRMTPVHHHFELGGLSGKGNPWSEWKVDFFFWGVGLLASLLTLAILYLM GT:EXON 1|1-326:0| SW:ID MRAY_STRP4 SW:DE RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase; EC=2.7.8.13;AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase; SW:GN Name=mraY; OrderedLocusNames=SPG_0306; SW:KW Cell cycle; Cell division; Cell membrane; Cell shape;Cell wall biogenesis/degradation; Complete proteome; Membrane;Peptidoglycan synthesis; Transferase; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->312|MRAY_STRP4|e-169|100.0|312/326| GO:SWS:NREP 9 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0009252|"GO:peptidoglycan biosynthetic process"|Peptidoglycan synthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 46->58|PS01347|MRAY_1|PDOC01046| PROS 162->173|PS01348|MRAY_2|PDOC01046| TM:NTM 10 TM:REGION 4->26| TM:REGION 51->73| TM:REGION 80->102| TM:REGION 116->138| TM:REGION 144->166| TM:REGION 170->192| TM:REGION 194->216| TM:REGION 220->242| TM:REGION 246->268| TM:REGION 304->326| SEG 55->72|lvfliasvlvafffalfs| SEG 313->325|llaslltlailyl| RP:PFM:NREP 1 RP:PFM:REP 81->240|PF00953|1e-20|47.0|149/162|Glycos_transf_4| HM:PFM:NREP 2 HM:PFM:REP 81->242|PF00953|2.9e-41|40.3|154/159|Glycos_transf_4| HM:PFM:REP 46->58|PF10555|4.8e-08|61.5|13/13|MraY_sig1| OP:NHOMO 1228 OP:NHOMOORG 889 OP:PATTERN ---1----111111--1---------------2111-1----------11-----1--1-1------- 1121311111111111111-11111111111111111211111211112221111112111111112122111111112112111111112415111--221112221211111111111111111112121111233332---322111112112221111211212221211123111111111111212212222222222222222122212222221222322222442222222222222222222222221121222221111222111222222222222211111111111222222222222222222222222222233333331312111222212211211122122222222112221112-1-1111111111111111111111111111111-111111111111111111111111111111111211111111111111111211111--------111111111111111111111111122222111111111111121111111111211121122211111111211111111211111111211112122111211211111121131211111112222111111112121222222212112111121121111111111123122121111111-11111-1-11112112112222222222-222222222222222222211112112121111111111111122222222111222222222221112111112222212111111112111121111-111111111121212211111211212111111111111111111111111111111111111111111221111111111112---------------------------2112211121111 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----1--1--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHEHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHEEEEHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHEEEcccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHc //