[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56551.1
DDBJ      :             conserved domain protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  119/915 : Eukaryota  47/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->144 1ve3B PDBj 1e-08 34.7 %
:RPS:PDB   47->214 3bxoA PDBj 6e-18 9.7 %
:RPS:SCOP  47->149 1xxlA  c.66.1.41 * 2e-15 29.0 %
:HMM:SCOP  3->255 1jqeA_ c.66.1.19 * 1.1e-32 23.5 %
:RPS:PFM   49->142 PF08241 * Methyltransf_11 4e-09 29.3 %
:HMM:PFM   49->146 PF08241 * Methyltransf_11 7.4e-24 31.6 95/95  
:BLT:SWISS 20->199 UBIE_LEPIN 4e-13 33.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56551.1 GT:GENE ACF56551.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1736122..1736895) GB:FROM 1736122 GB:TO 1736895 GB:DIRECTION - GB:PRODUCT conserved domain protein GB:NOTE identified by match to protein family HMM PF08241; match to protein family HMM PF08242 GB:PROTEIN_ID ACF56551.1 GB:DB_XREF GI:194358103 LENGTH 257 SQ:AASEQ MIDKVIEQYKSHDNLDIRVELHKKYSKNKLGFNNWIFSNYQITDEVKVLELGCGTGELWKSNSDSIDKMKQLIVTDFSKDMVKSTKSVIGNRNNVNYEIMDIQKISFENETFDIVIANMLLHHVNDIPKALSEVNRVLKTGGIFYCATFGENGVVNYLASLFKDEVNQDLENRTFTLQNGKRYLSRYFNSVDTLLYDDELQVTSIDDLVKYIQSFKGISEIGSLEEEIIRKRLESEFNNGMLIIPKEYGMFIARKES GT:EXON 1|1-257:0| BL:SWS:NREP 1 BL:SWS:REP 20->199|UBIE_LEPIN|4e-13|33.7|169/249| SEG 217->229|giseigsleeeii| BL:PDB:NREP 1 BL:PDB:REP 47->144|1ve3B|1e-08|34.7|95/222| RP:PDB:NREP 1 RP:PDB:REP 47->214|3bxoA|6e-18|9.7|165/236| RP:PFM:NREP 1 RP:PFM:REP 49->142|PF08241|4e-09|29.3|92/96|Methyltransf_11| HM:PFM:NREP 1 HM:PFM:REP 49->146|PF08241|7.4e-24|31.6|95/95|Methyltransf_11| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF08241|IPR013216| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF08241|IPR013216| RP:SCP:NREP 1 RP:SCP:REP 47->149|1xxlA|2e-15|29.0|100/234|c.66.1.41| HM:SCP:REP 3->255|1jqeA_|1.1e-32|23.5|251/0|c.66.1.19|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 228 OP:NHOMOORG 173 OP:PATTERN -------------------------11-----------------1--1--11-------1-------- -1-------------21-------12-----1-1111111------------------------1-1-----------1------1----------1------1-1----------------------------1---------1-11----------------------1-----------------------33333234-33333311--1-334----------------1111111111111111111--------1-1------------------------1----1---1----------------------------121111111211--33----11----2--1111---------------------------------------------------------------111----11---------------------------------------------------------------1-------------------------111-1----------------------------------------------1-------------------------------1---------------------------------------------------------------------11---------------------------------------------1-------------1--------1---------------------1111----------------------------------------------------------1------------11-----------------122--11------------------------------------------------- 2----1------111--------1-11-------------------11------------------------1---------1-1-----2------------2----2---1---11--1-1-11-2-131-11111--1-111-1---1-11-2211-11---1--------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 256 STR:RPRED 99.6 SQ:SECSTR HHHHHHHHHHHHHTGGGccHHHHHHHHHHTTcTHHHHHHHHHHcccEEEEETcTTcHHHHHHHHTccHHcEEEEEEccHHHHHHHHHHcTTcEEEEccTTTccccccEEEEEEcTTGGGGcccHHHHHHHHHHHHHTEEEEEEEEEcccccTTTccTTcEEEEEEEETTEEETTEEEEEEEEEEEETTTEEEEEEEEEEEEcccHHHHHHHHHHTHHHHHHHcHHHHHHHHHHHHHHTcTTEccccEEEEEEEEcc# DISOP:02AL 257-258| PSIPRED cHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHcccccEEEEEEccHHHHHHHHHHcccccccEEEEccHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccEEEEEccccEEEccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccEEEEEEEEEEEEEEccc //