[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56552.1
DDBJ      :             response regulator TCS01
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  848/915 : Eukaryota  50/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:225 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->223 2oqrA PDBj 6e-33 32.7 %
:RPS:PDB   1->220 3c3wB PDBj 1e-31 22.5 %
:RPS:SCOP  3->118 1a0oA  c.23.1.1 * 3e-26 26.7 %
:RPS:SCOP  123->223 1ys6A1  a.4.6.1 * 2e-21 28.7 %
:HMM:SCOP  1->189 1s8nA_ c.23.1.1 * 7.7e-35 27.8 %
:RPS:PFM   4->113 PF00072 * Response_reg 2e-19 39.1 %
:RPS:PFM   147->222 PF00486 * Trans_reg_C 1e-15 44.7 %
:HMM:PFM   4->112 PF00072 * Response_reg 3.7e-28 33.0 109/112  
:HMM:PFM   147->221 PF00486 * Trans_reg_C 2.9e-25 44.0 75/77  
:BLT:SWISS 1->223 BCER_BACHD 7e-56 47.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56552.1 GT:GENE ACF56552.1 GT:PRODUCT response regulator TCS01 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1485203..1485880) GB:FROM 1485203 GB:TO 1485880 GB:DIRECTION - GB:PRODUCT response regulator TCS01 GB:NOTE identified by match to protein family HMM PF00072; match to protein family HMM PF00486 GB:PROTEIN_ID ACF56552.1 GB:DB_XREF GI:194358104 LENGTH 225 SQ:AASEQ MHKILLIEDDQVIRQQVGKMLSEWGFEVVLVEDFMEVLSLFVQSEPHLVLMDIGLPLFNGYHWCQEIRKISKVPIMFLSSRDQAMDIVMAINMGADDFVTKPFDQQVLLAKVQGLLRRSYEFGRDESLLEYAGVILNTKSMDLHYQGQVLNLTKNEFQILRVLFEHAGNIVARDDLMRELWNSDFFIDDNTLSVNVARLRKKLEEQGLVGFIETKKGIGYGLKHA GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 1->223|BCER_BACHD|7e-56|47.1|223/231| BL:PDB:NREP 1 BL:PDB:REP 4->223|2oqrA|6e-33|32.7|217/226| RP:PDB:NREP 1 RP:PDB:REP 1->220|3c3wB|1e-31|22.5|204/210| RP:PFM:NREP 2 RP:PFM:REP 4->113|PF00072|2e-19|39.1|110/111|Response_reg| RP:PFM:REP 147->222|PF00486|1e-15|44.7|76/77|Trans_reg_C| HM:PFM:NREP 2 HM:PFM:REP 4->112|PF00072|3.7e-28|33.0|109/112|Response_reg| HM:PFM:REP 147->221|PF00486|2.9e-25|44.0|75/77|Trans_reg_C| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00486|IPR001867| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00486|IPR001867| GO:PFM GO:0003677|"GO:DNA binding"|PF00486|IPR001867| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00486|IPR001867| RP:SCP:NREP 2 RP:SCP:REP 3->118|1a0oA|3e-26|26.7|116/128|c.23.1.1| RP:SCP:REP 123->223|1ys6A1|2e-21|28.7|101/106|a.4.6.1| HM:SCP:REP 1->189|1s8nA_|7.7e-35|27.8|187/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 11231 OP:NHOMOORG 915 OP:PATTERN -----------------------------1-1--11--1111111-18-6312--------------- 7EJ7N466778555CCCAA-AH44ABAAAAA9HEFFBGGEA9CEBB686897DDG45811JHL5M6HPMP8444444458JA714367GFSM-D22---46J4B9Q7J8J--------------142332247284NNNNNH8DY5uemfaZDKLFH777AA9SULFkk*M584554574544DG877451AAHUUVUVSUWHWTXWUSGJECCEVWcABEX9FEA99A9Ajb7BB9A99899BBB998A996B675CC645466666CC655675686CDC9668A88888888988885665667768656A7666465676XKLfRRRWVVWTTMFeVV9DFBSLH8BCHNA6cXLAB736757697328GA9HGGB66666FDNLPFADENFIL9989999988C-GIFGHLHM9KA2PIIMLJKSRMHFHL9D8D9EE8DDDEBCCCCCCCCABB88NEC2222211111112233222222222222237BD56BEDAFOQTSWOLIIIDOORSLJLKCKUMQMQMT12JPMQAJFDaILJN8HNKAD9CD82322212A87GJVCOHAA2C95JI446-LGNJJJIEAEEFFLPACM9A96777777333433333HLACK44HG8EJNN8HECJIOOMCLGMJJKJKIIMOM--38848------EGDFEFAFGGGFGGHFG-GIGFFFFGFHGFGGGEGGDIIJCE988FEFFFFFFEFFDFDFFHEDEEEFF91EFFFFFEFFGFF--3E3333345448EbAL444333244443115EECDF8C99CJIRPSRVZZcKWZZXLRQU3212132129GHHPFFFFFKKNKLNQFAHABFGF7656--R18866881-------3-2-------------------------39446565455I3 -----1--------3----22211-1122-212-1-12222121-211-----1---------1-----1--1-1------111--1---------1------111----------------------------------------------------1----1-1-------3-123-------3--A---2-9---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 224 STR:RPRED 99.6 SQ:SECSTR cEEEEEEcccHHHHHHHHHHHHTcTTEEEEEEcHHHHHHHHHHHcccEEEEccEETTEEHHHHHHHHHHHTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHHGEEGGGccHHHHHHHHHHHHHHHccTTTTccHHHHHHHHHHTTTccHHHEEEEcEEETHHHHHTccHHHHHHHHHHHHHHTTcccccHHHHHHHHHTccccc# DISOP:02AL 119-128,225-226| PSIPRED ccEEEEEEccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHcccccEEEEEccccHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHccccccccccEEEEccEEEEcccEEEEEccEEEEccHHHHHHHHHHHHcccccccHHHHHHHHccccccccccEEEHHHHHHHHHccccccccEEEEEcccEEEEEcc //