[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56556.1
DDBJ      :             Cytosine/adenosine deaminase
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  682/915 : Eukaryota  121/199 : Viruses  0/175   --->[See Alignment]
c.97.1
:106 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->100 2nx8A PDBj 1e-35 69.0 %
:RPS:PDB   9->101 2b3jD PDBj 2e-19 48.4 %
:RPS:SCOP  27->101 1tiyA  c.97.1.2 * 5e-24 41.3 %
:HMM:SCOP  6->101 2a8nA1 c.97.1.2 * 7.1e-33 48.4 %
:RPS:PFM   8->101 PF00383 * dCMP_cyt_deam_1 8e-13 37.6 %
:HMM:PFM   7->101 PF00383 * dCMP_cyt_deam_1 4.4e-27 39.4 94/102  
:BLT:SWISS 1->100 Y196_STRP8 3e-35 69.0 %
:PROS 57->94|PS00903|CYT_DCMP_DEAMINASES
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56556.1 GT:GENE ACF56556.1 GT:PRODUCT Cytosine/adenosine deaminase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 23424..23744 GB:FROM 23424 GB:TO 23744 GB:DIRECTION + GB:PRODUCT Cytosine/adenosine deaminase GB:NOTE contains potential frameshift; identified by match to protein family HMM PF00383 GB:PROTEIN_ID ACF56556.1 GB:DB_XREF GI:194358108 LENGTH 106 SQ:AASEQ MYYTLEEKEVFMREALREAEIALEHDEIPIGCVIVKDGEIIGRGHNAREELQRAVMHAEIMAIEDANLSEESWRLLDCTLFVTIEPCVMCSGAIGLARIPKCGLWG GT:EXON 1|1-106:0| BL:SWS:NREP 1 BL:SWS:REP 1->100|Y196_STRP8|3e-35|69.0|100/159| PROS 57->94|PS00903|CYT_DCMP_DEAMINASES|PDOC00702| TM:NTM 1 TM:REGION 75->97| SEG 13->24|realreaeiale| BL:PDB:NREP 1 BL:PDB:REP 1->100|2nx8A|1e-35|69.0|100/168| RP:PDB:NREP 1 RP:PDB:REP 9->101|2b3jD|2e-19|48.4|93/150| RP:PFM:NREP 1 RP:PFM:REP 8->101|PF00383|8e-13|37.6|93/100|dCMP_cyt_deam_1| HM:PFM:NREP 1 HM:PFM:REP 7->101|PF00383|4.4e-27|39.4|94/102|dCMP_cyt_deam_1| GO:PFM:NREP 2 GO:PFM GO:0008270|"GO:zinc ion binding"|PF00383|IPR002125| GO:PFM GO:0016787|"GO:hydrolase activity"|PF00383|IPR002125| RP:SCP:NREP 1 RP:SCP:REP 27->101|1tiyA|5e-24|41.3|75/157|c.97.1.2| HM:SCP:REP 6->101|2a8nA1|7.1e-33|48.4|93/0|c.97.1.2|1/1|Cytidine deaminase-like| OP:NHOMO 901 OP:NHOMOORG 815 OP:PATTERN --------------------------------1-----111111-1-1-2-11--------------- -11-1-11---1-1--------11-1--------------1-21-11-1--111111111--11-1111-111111111111-11111111211111--1111112111111111111111111111111111111----------213211111221-111111212221111111-11111-----111111111111111111111112222111111121111111121111111--11111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111121111111111111111-1111----121---11111-12111111111111111111111---1----1-1---111--11-11-111---1--------11111111---1-11---1-1111----1111-111111111-1-----111111--------1111----11111---1-----111-1111111-1-11111-111-1111111111112211221--2-1--1121111111211111-1---------------------21--111--11111121112222111222212112-11-1----11111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111222221111211111111111111111111111111111-2111121111---112221111111111111-11111111111111111111111111----11------------11-1--------------------------------121 ----11-----1--12221-112111122--11111-111-1111---11------------1-11-1-11111111-111---1----23121111-111-1-----11--11231---111-1111-131-11111--11111-1---1--1111112-112-------22-111122---1242221111-22211 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 96.2 SQ:SECSTR cccccHHHHHHHHHHHHHHHHHHTTTccccEEEEEETTEEEEEEEccHHHHTcTTccHHHHHHHHHHHHHTccccTTcEEEEEEcccHHHHHHHHHHTccEE#### DISOP:02AL 1-1| PSIPRED ccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccEEEEEEccccccccccccHHHHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHccccEEEEEc //