[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56560.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:119 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   28->118 PF11877 * DUF3397 2e-05 44.0 %
:HMM:PFM   6->117 PF11877 * DUF3397 1.7e-32 45.5 112/116  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56560.1 GT:GENE ACF56560.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(584863..585222) GB:FROM 584863 GB:TO 585222 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF56560.1 GB:DB_XREF GI:194358112 LENGTH 119 SQ:AASEQ MGMILMKLASILLLILTLVVCIILTKLFRLKKLGRNFADLAFPVLVFEYYLITAKTFTHNFLPRLGLTLSILAIILVFFFLLKKRSFYYPKFIKFFWRAGFLLTLIMYVEMIVELFLMK GT:EXON 1|1-119:0| TM:NTM 4 TM:REGION 5->27| TM:REGION 35->57| TM:REGION 61->82| TM:REGION 97->119| SEG 3->27|milmklasillliltlvvciiltkl| SEG 69->82|lsilaiilvfffll| RP:PFM:NREP 1 RP:PFM:REP 28->118|PF11877|2e-05|44.0|91/117|DUF3397| HM:PFM:NREP 1 HM:PFM:REP 6->117|PF11877|1.7e-32|45.5|112/116|DUF3397| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1111--11111111111-------------111---1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //