[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56561.1
DDBJ      :             peptidase, M50 family
Swiss-Prot:Y242_STRR6   RecName: Full=Putative zinc metalloprotease spr0242;         EC=3.4.24.-;

Homologs  Archaea  0/68 : Bacteria  681/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
a.211.1b.36.1
:419 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   206->286 3id2A PDBj 2e-04 26.0 %
:RPS:PDB   15->187 3ejxD PDBj 5e-09 19.8 %
:RPS:PDB   206->274 2db5A PDBj 4e-04 14.9 %
:RPS:SCOP  18->133 1u6zA1  a.211.1.5 * 2e-04 19.8 %
:RPS:SCOP  207->274 1y8tA1  b.36.1.4 * 2e-05 25.8 %
:HMM:SCOP  173->270 1ky9A1 b.36.1.4 * 0.00011 21.7 %
:RPS:PFM   7->70,147->409 PF02163 * Peptidase_M50 8e-27 36.0 %
:HMM:PFM   6->412 PF02163 * Peptidase_M50 4.3e-80 45.1 193/193  
:BLT:SWISS 1->419 Y242_STRR6 0.0 100.0 %
:PROS 15->24|PS00142|ZINC_PROTEASE
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56561.1 GT:GENE ACF56561.1 GT:PRODUCT peptidase, M50 family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 232567..233826 GB:FROM 232567 GB:TO 233826 GB:DIRECTION + GB:PRODUCT peptidase, M50 family GB:NOTE identified by match to protein family HMM PF02163; match to protein family HMM TIGR00054 GB:PROTEIN_ID ACF56561.1 GB:DB_XREF GI:194358113 LENGTH 419 SQ:AASEQ MLGILTFILVFGIIVVVHEFGHFYFAKKSGILVREFAIGMGPKIFAHIGKDGTAYTIRILPLGGYVRMAGWGDDTTEIKTGTPVSLTLADDGKVKRINLSGKKLDQTALPMQVTQFDFEDKLFIKGLVLEEEKTFAVDHDATVVEADGTEVRIAPLDVQYQNATIWGKLITNFAGPMNNFILGVVVFWVLIFMQGGVRDVDTNQFHIMPQGALAKVGVPETAQITKIGSHEVSNWESLIQAVETETKDKTAPTLDVTISEKGSDKQVTVTPEDSQGRYLLGVQPGVKSDFLSMFVGGFTTAADSALRILSALKNLIFQPDLNKLGGPVAIFKASSDAAKNGIENILYFLAMISINIGIFNLIPIPALDGGKIVLNILEAIRRKPLKQEIETYVTLAGVVIMVVLMIAVTWNDIMRLFFR GT:EXON 1|1-419:0| SW:ID Y242_STRR6 SW:DE RecName: Full=Putative zinc metalloprotease spr0242; EC=3.4.24.-; SW:GN OrderedLocusNames=spr0242; SW:KW Cell membrane; Complete proteome; Hydrolase; Membrane; Metal-binding;Metalloprotease; Protease; Transmembrane; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->419|Y242_STRR6|0.0|100.0|419/419| GO:SWS:NREP 7 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008237|"GO:metallopeptidase activity"|Metalloprotease| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 15->24|PS00142|ZINC_PROTEASE|PDOC00129| TM:NTM 4 TM:REGION 1->23| TM:REGION 175->197| TM:REGION 350->372| TM:REGION 389->411| BL:PDB:NREP 1 BL:PDB:REP 206->286|3id2A|2e-04|26.0|77/90| RP:PDB:NREP 2 RP:PDB:REP 15->187|3ejxD|5e-09|19.8|172/301| RP:PDB:REP 206->274|2db5A|4e-04|14.9|67/128| RP:PFM:NREP 1 RP:PFM:REP 7->70,147->409|PF02163|8e-27|36.0|298/331|Peptidase_M50| HM:PFM:NREP 1 HM:PFM:REP 6->412|PF02163|4.3e-80|45.1|193/193|Peptidase_M50| GO:PFM:NREP 2 GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF02163|IPR008915| GO:PFM GO:0006508|"GO:proteolysis"|PF02163|IPR008915| RP:SCP:NREP 2 RP:SCP:REP 18->133|1u6zA1|2e-04|19.8|111/197|a.211.1.5| RP:SCP:REP 207->274|1y8tA1|2e-05|25.8|66/88|b.36.1.4| HM:SCP:REP 173->270|1ky9A1|0.00011|21.7|92/94|b.36.1.4|1/1|PDZ domain-like| OP:NHOMO 706 OP:NHOMOORG 689 OP:PATTERN -------------------------------------------------------------------- 111-----111--------------------------1--1-----------------11------------------11--1111111111-1111--1--------1----------------111122111111-------1111----1--11-----1-111-1-1--1-111---11-11--11111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-1111111111111111111111111111-111121111111111111111111--11-11111111111111111111111111111111111111--111----1--111111111111111111111111111111111111111111111111-------11-1-11111111--------11111111111-1-111111111111111222221211111-1111111-1-------11111111111111111111111111111111111111-11111------11111111111111111-111111111111111111111111111111111111111111111111111111111111111111-11121--2222-111111111111111111111111111111111111111111111111----------11111111111111--1111111111111-1---1111--------1-1-------------------------1111111111-1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----111112------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 255 STR:RPRED 60.9 SQ:SECSTR ##############EEEEcTTccccHHHHHHHcTTTcccccEEEEEEEccTTccEEEEEETTcccccccHHHHccEEccEEETEEEEEcTTccE#EEEcccccccGGGTTcccccccTTccccEEEEETTEEEEEEEEEEEEcccTTcccccGGGccHHHHHHHHHTccEEEEEEEEETTEEEEEEE##################cccTTcHHHHTcccccccEEEEccccccTTccHHHHHHHHHHcccTcEEEEEEEEcccccccccccccccTTEEccEEccccc################################################################################################################################### DISOP:02AL 71-86| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEcccEEEEEEEcccEEEEEEEEEEccEEcccccccccccccccccccccccccccEEEEEcccccccccccEEEEccccccccEEEEEEEEcccEEEEEccccEEEEEccEEEEEcccccHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccEEEEEccccHHHHcccccccEEEEEccEEcccHHHHHHHHHHHcccccccEEEEEEEEccEEEEEEEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //