[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56577.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  68/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   23->91 PF06103 * DUF948 4e-15 63.8 %
:HMM:PFM   4->92 PF06103 * DUF948 1.2e-31 50.6 89/90  
:BLT:SWISS 34->92 DNAK_PSEHT 1e-04 42.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56577.1 GT:GENE ACF56577.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1315497..1315880) GB:FROM 1315497 GB:TO 1315880 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF06103 GB:PROTEIN_ID ACF56577.1 GB:DB_XREF GI:194358129 LENGTH 127 SQ:AASEQ MLEVAYILVALALIVFLVYLIITVQKLGRVIDETEKTIKTLTSDVDVTLHHTNELLAKVNVLADDINVKVATIDPLFSAVADLSLSVSDLNDHARVLSKKASSAGSKTLKTGASLSALRLASKFFKK GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 34->92|DNAK_PSEHT|1e-04|42.1|57/638| TM:NTM 1 TM:REGION 5->27| SEG 4->22|vayilvalalivflvylii| RP:PFM:NREP 1 RP:PFM:REP 23->91|PF06103|4e-15|63.8|69/90|DUF948| HM:PFM:NREP 1 HM:PFM:REP 4->92|PF06103|1.2e-31|50.6|89/90|DUF948| OP:NHOMO 68 OP:NHOMOORG 68 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111-11111111111-11111111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,96-112| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcc //