[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56586.1
DDBJ      :             hemolysin A, putative
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  508/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.66.1d.66.1
:271 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->269 3hp7A PDBj e-108 79.0 %
:RPS:PDB   2->82 1dm9A PDBj 1e-08 15.2 %
:RPS:PDB   83->213 3cjtA PDBj 8e-08 13.8 %
:RPS:SCOP  2->73 1jh3A  d.66.1.4 * 8e-11 17.1 %
:RPS:SCOP  83->209 2fpoA1  c.66.1.46 * 2e-07 11.0 %
:HMM:SCOP  5->102 1c06A_ d.66.1.2 * 1.8e-15 34.4 %
:HMM:SCOP  62->248 1l9kA_ c.66.1.25 * 3e-23 26.4 %
:RPS:PFM   63->117 PF01728 * FtsJ 3e-05 41.8 %
:HMM:PFM   62->243 PF01728 * FtsJ 1.3e-19 29.0 155/181  
:HMM:PFM   4->46 PF01479 * S4 6.5e-06 26.8 41/48  
:BLT:SWISS 3->271 YQXC_BACSU 3e-71 55.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56586.1 GT:GENE ACF56586.1 GT:PRODUCT hemolysin A, putative GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1074870..1075685) GB:FROM 1074870 GB:TO 1075685 GB:DIRECTION - GB:PRODUCT hemolysin A, putative GB:NOTE identified by match to protein family HMM PF01479; match to protein family HMM PF01728; match to protein family HMM TIGR00478 GB:PROTEIN_ID ACF56586.1 GB:DB_XREF GI:194358138 LENGTH 271 SQ:AASEQ MAKERVDVLAYKQGLFETREQAKRGVMAGLVVAVLNGERFDKPGEKIPDDTELKLKGEKLKYVSRGGLKLEKALQVFDLSVDGATTIDIGASTGGFTDVMLQNSAKLVFAVDVGTNQLAWKLRQDPRVVSMEQFNFRYAEKTDFEQEPSFASIDVSFISLSLILPALHRVLADQGQVVALVKPQFEAGREQIGKNGIIRDAKVHQNVLESVTAMAVEVGFSVLGLDFSPIQGGHGNIEFLAYLKKEKSASNQILAEIKEAVERAHSQFKNE GT:EXON 1|1-271:0| BL:SWS:NREP 1 BL:SWS:REP 3->271|YQXC_BACSU|3e-71|55.1|267/281| BL:PDB:NREP 1 BL:PDB:REP 3->269|3hp7A|e-108|79.0|262/270| RP:PDB:NREP 2 RP:PDB:REP 2->82|1dm9A|1e-08|15.2|79/104| RP:PDB:REP 83->213|3cjtA|8e-08|13.8|130/254| RP:PFM:NREP 1 RP:PFM:REP 63->117|PF01728|3e-05|41.8|55/179|FtsJ| HM:PFM:NREP 2 HM:PFM:REP 62->243|PF01728|1.3e-19|29.0|155/181|FtsJ| HM:PFM:REP 4->46|PF01479|6.5e-06|26.8|41/48|S4| GO:PFM:NREP 3 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF01728|IPR002877| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01728|IPR002877| GO:PFM GO:0032259|"GO:methylation"|PF01728|IPR002877| RP:SCP:NREP 2 RP:SCP:REP 2->73|1jh3A|8e-11|17.1|70/99|d.66.1.4| RP:SCP:REP 83->209|2fpoA1|2e-07|11.0|127/177|c.66.1.46| HM:SCP:REP 5->102|1c06A_|1.8e-15|34.4|96/159|d.66.1.2|1/1|Alpha-L RNA-binding motif| HM:SCP:REP 62->248|1l9kA_|3e-23|26.4|159/0|c.66.1.25|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 533 OP:NHOMOORG 524 OP:PATTERN ------------------------------------------------1------------------- 1111111111111111111-11111111111111111111111111111111111111--1111111111111111111112111111------------------------------------------------11111---111111111111111111111111111111111111111---111111111111111111111111111111111111111111111111-------------------111111111-111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111-11-1-111111111111111111111111111111111-11111111111-11111111111111111----------1111111111111111------------1111111111111-----11111--------------------------------------11111111111-------11-----------11111111111111111111111111111111111111111111111111111111111-------1---------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------------------------------------------1111111111111111--1----1--111---111111-1-11111-1111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1117111111111-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 269 STR:RPRED 99.3 SQ:SECSTR HTcccHHHHHHHTTccccHHHHHHHHHTTcEccEETTEEccTTcccTTcEEEEEETTEEEEEEEcccccccccHHHHGGGEETcEEEEEccTTcHHHHHHHHTTcEEEEEEEccGGGHHHHHHHHHTTTcccEEEEccHHHHGGGccEEEEEEEccHHHHHHHHHHHHHHEEEEEEEEEEEGGGHHHHHHHHHHTTcEEEEEEEETTEEEEEETTTTcEEEEccEEEEEccGGGTTTTTHHHHHHHHHHHHHHTTTcHHHHHHHHHHHH## DISOP:02AL 1-1,265-272| PSIPRED ccHHHHHHHHHHccccccHHHHHHHHHcccEEEccccEEEEccccccccccEEEEEEccccccccHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHccccEEEEEEEccccccHHHHccccEEEEccccHHHccHHHccccccEEEEEccHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHcccccccccHHHHHHHHHHHHHHHHHccccEEEEEccccccccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHHcc //