[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56591.1
DDBJ      :             ATP-dependent RNA helicase, DEAD/DEAH box helicase
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  828/915 : Eukaryota  198/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:447 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->336 2i4iA PDBj 5e-52 38.4 %
:RPS:PDB   1->340 1cu1A PDBj 6e-57 10.3 %
:RPS:SCOP  2->208 1fuuA  c.37.1.19 * 5e-40 32.5 %
:RPS:SCOP  215->398 1a1vA2  c.37.1.14 * 3e-22 12.6 %
:HMM:SCOP  68->360 1wp9A2 c.37.1.19 * 1.6e-64 32.1 %
:RPS:PFM   27->191 PF00270 * DEAD 1e-29 43.2 %
:RPS:PFM   262->335 PF00271 * Helicase_C 2e-13 37.8 %
:HMM:PFM   25->191 PF00270 * DEAD 3e-47 38.7 163/167  
:HMM:PFM   261->337 PF00271 * Helicase_C 7.1e-23 39.0 77/78  
:HMM:PFM   209->263 PF02558 * ApbA 0.00096 18.2 55/151  
:BLT:SWISS 3->374 CSHB_BACSU e-107 49.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56591.1 GT:GENE ACF56591.1 GT:PRODUCT ATP-dependent RNA helicase, DEAD/DEAH box helicase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 674574..675917 GB:FROM 674574 GB:TO 675917 GB:DIRECTION + GB:PRODUCT ATP-dependent RNA helicase, DEAD/DEAH box helicase GB:NOTE identified by match to protein family HMM PF00270; match to protein family HMM PF00271 GB:PROTEIN_ID ACF56591.1 GB:DB_XREF GI:194358143 LENGTH 447 SQ:AASEQ MSFTKFQFKNYIREALKELKFTTPTEVQDKLIPIVLAGRDLVGESKTGSGKTHTFLLPIFQQLDEASDSVQAVITAPSRELATQIYQVARQISAHSDVEVRVVNYVGGTDKARXIEKLASNQPHIVIGTPGRIYDLVKSGDLAIHKAKTFVVDEADMTLDMGFLEIVDKIAGSLPKDLQFMVFSATIPQKLQPFLKKYLSNPVMEKIKTKTVISDTIDNWLISTKGHDKNAQIYQLTQLMQPYLAMIFVNTKTRADELHSYLTAQGLKVAKIHGDIAPRERKRIMNQVQNLDFEYIVATDLAARGIDIEGVSHVINDAIPQDLSFFVHRVGRTGRNGLPGTAITLYQPSDDSDIRELEKLGIKFSPKMVKDGEFQDTYDRDRRANREKKQDKLDIEMIGLVKKKKKKVKPGYKKKIQWAVDEKRRKTKRAENRARGRAERKAKRQTF GT:EXON 1|1-447:0| BL:SWS:NREP 1 BL:SWS:REP 3->374|CSHB_BACSU|e-107|49.9|371/438| SEG 402->415|kkkkkkvkpgykkk| SEG 428->444|kraenrargraerkakr| BL:PDB:NREP 1 BL:PDB:REP 2->336|2i4iA|5e-52|38.4|328/408| RP:PDB:NREP 1 RP:PDB:REP 1->340|1cu1A|6e-57|10.3|300/645| RP:PFM:NREP 2 RP:PFM:REP 27->191|PF00270|1e-29|43.2|162/167|DEAD| RP:PFM:REP 262->335|PF00271|2e-13|37.8|74/76|Helicase_C| HM:PFM:NREP 3 HM:PFM:REP 25->191|PF00270|3e-47|38.7|163/167|DEAD| HM:PFM:REP 261->337|PF00271|7.1e-23|39.0|77/78|Helicase_C| HM:PFM:REP 209->263|PF02558|0.00096|18.2|55/151|ApbA| GO:PFM:NREP 6 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF00270|IPR011545| GO:PFM GO:0005524|"GO:ATP binding"|PF00270|IPR011545| GO:PFM GO:0008026|"GO:ATP-dependent helicase activity"|PF00270|IPR011545| GO:PFM GO:0003676|"GO:nucleic acid binding"|PF00271|IPR001650| GO:PFM GO:0004386|"GO:helicase activity"|PF00271|IPR001650| GO:PFM GO:0005524|"GO:ATP binding"|PF00271|IPR001650| RP:SCP:NREP 2 RP:SCP:REP 2->208|1fuuA|5e-40|32.5|203/215|c.37.1.19| RP:SCP:REP 215->398|1a1vA2|3e-22|12.6|183/296|c.37.1.14| HM:SCP:REP 68->360|1wp9A2|1.6e-64|32.1|271/0|c.37.1.19|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 10495 OP:NHOMOORG 1083 OP:PATTERN ---2-23233333343221222111--1-1-11111111111122123-22221--111121221-22 1221333333332332322-23113322222233333555-32333432554444323--4432333564211112221131-11121446514332--73787379827--------------232122222223111111111121-2111----12122121-2223211111111111141111--1125777777776777777535555777222546466666675344444444444444344443444554445455444434444224433333333333333333323333333333333333333333333-533866666666673522555535-2-133114535-1121----1-414-3323322212333333223333333333333333-3333333323223333443333333324333233334324444444435553323------------211112112111111111333424444355555554444555544443455544452344454544565554554343353222222232244573625253214333-454535545333365524--1-------1111111116111522AA8746B799ABCDCCDDDDDDCCDDCCCC1-2222311111165566666666666666-66666666666566666666666655666666666666565566665666651655667755667114511111433425549434334344344333332242222256666676666666667663222222225BBBBAAAAA9CCBB44555555553333232-442233--1-----21322232---1--12---11121-11121111------33 QPOOUUP5*QOKQOSNOPMMNNNNONNNNNNNNMMMMPMNMNNONMNONONNOOMNNNNNNNOONMNNHPQOOOOOPLPQNPNOONMN-NbQOOQURPPOPNQcdcCS*U*jugofvYTUNWbTtpR*U**l3vi*QYWRkUYhUNaZTRcTLwVhTTaY*vgZUTViXe*hjfRLaWh*gebQYvj**Q*rYVeWZac --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 398 STR:RPRED 89.0 SQ:SECSTR EETTEEEEEEEEEHHHHHHHHHccccccccccccccccEEEEEEccccccTTTHHHHHHHTTTTTTcccccEEEEEccHHHHHHHHHHHHHHTccTTccEcEEEccTccEEEccccccccccccEEEEEHHHHHHHTcccTTcccEEEEETTTcccHHHHHHHHHHHHHTTTTTccEEEEEEcccTTccccccTTEEEEEcccccccccccccEEcccEEEccHHHcEEETTEEEcGGGTcccEEEEEccccHHHHHHHHHHHHTTccEEEEcTTcccccccccccEEEEEcTTHHHHccccccEEEEccEEEEEEEEcccEEEEEEEEccHHHHHHHHTEEEEEEEHTHHHcccHHHHTTcccEEGGHccTTcHHTGGGGHHHHHHHTTcHHHTHTT################################################# DISOP:02AL 374-448| PSIPRED ccHHHccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHcccccEEEcccHHHHHHHHcccccccccEEEEEEccHHHcccccHHHHHHHHHHccHHHcEEEEEccccHHHHHHHHHHccccEEEEEccccccccccEEEEEEEcHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHcccccEEEEccHHHcccccccccEEEEccccccHHHHccccccccccccccEEEEEEcHHHHHHHHHHHHHccccccEEcccccccHHHHHHHHHHHHHHHHcccHHHHHHHccccHHccccccHHHHHHHHHHHHHHHccccccccHHHHHHccccc //