[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56595.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->29 PF04650 * YSIRK_signal 2e-04 56.5 %
:HMM:PFM   7->32 PF04650 * YSIRK_signal 4.9e-15 57.7 26/27  
:HMM:PFM   29->56 PF03450 * CO_deh_flav_C 0.0007 21.4 28/103  
:BLT:SWISS 8->79 SDRD_STAAW 9e-07 31.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56595.1 GT:GENE ACF56595.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1983183..1983434) GB:FROM 1983183 GB:TO 1983434 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF56595.1 GB:DB_XREF GI:194358147 LENGTH 83 SQ:AASEQ MKEFQFERKQRFSLRKYAIGACSVLLGTSLFFAGMGDQPVQDTETSSALISSHYLDEQDLSEKLKSELQWFELENKLLNLWEH GT:EXON 1|1-83:0| BL:SWS:NREP 1 BL:SWS:REP 8->79|SDRD_STAAW|9e-07|31.0|71/1347| RP:PFM:NREP 1 RP:PFM:REP 7->29|PF04650|2e-04|56.5|23/27|YSIRK_signal| HM:PFM:NREP 2 HM:PFM:REP 7->32|PF04650|4.9e-15|57.7|26/27|YSIRK_signal| HM:PFM:REP 29->56|PF03450|0.0007|21.4|28/103|CO_deh_flav_C| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF04650|IPR005877| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,7-7,42-84| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //