[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56601.1
DDBJ      :             PTS system,  IIBC component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  346/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.95.1
:505 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   432->501 1o2fB PDBj 1e-06 31.4 %
:RPS:PDB   431->501 3bp8C PDBj 4e-18 43.7 %
:RPS:SCOP  431->501 3bp8C1  d.95.1.1 * 2e-18 43.7 %
:HMM:SCOP  427->503 1o2fB_ d.95.1.1 * 4.6e-18 36.4 %
:RPS:PFM   52->332 PF02378 * PTS_EIIC 6e-28 38.7 %
:RPS:PFM   431->463 PF00367 * PTS_EIIB 8e-08 54.5 %
:HMM:PFM   9->332 PF02378 * PTS_EIIC 3.4e-77 36.8 304/321  
:HMM:PFM   431->463 PF00367 * PTS_EIIB 6.3e-14 48.5 33/35  
:BLT:SWISS 1->501 PTG3C_STAS1 2e-96 45.6 %
:PROS 441->458|PS01035|PTS_EIIB_TYPE_1_CYS
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56601.1 GT:GENE ACF56601.1 GT:PRODUCT PTS system, IIBC component GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1533846..1535363) GB:FROM 1533846 GB:TO 1535363 GB:DIRECTION - GB:PRODUCT PTS system, IIBC component GB:NOTE identified by match to protein family HMM PF00367; match to protein family HMM PF02378; match to protein family HMM TIGR00826 GB:PROTEIN_ID ACF56601.1 GB:DB_XREF GI:194358153 LENGTH 505 SQ:AASEQ MFKVLQKVGKAFMLPIAILPAAGLLLGIGGALSNPTTIATYPILDNSIFQSIFQVMSSAGEVVFSNLSLLLCVGLCIGLAKRDKGTAALAGVTGYLVMTATIKALVKLFMAEGSAIDTGVIGALAVGIVAVYLHNRYNNIQLPSALGFFGGSRFVPIVTSFSSILIGFVFFVIWPPFQQLLVSTGGYISQAGPIGTFLYGFLMRLSGAVGLHHIIYPMFWYTELGGVETIAGQTVVGAQKIFFAQLADPAHSGLFTEGTRFFAGRFSTMMFGLPAACLAMYHSVPKNRRKKYAGLFFGVALTSFITGITEPIEFMFLFVSPVLYVVHAFLDGVSFFIADVLNISIGNTFSGGVIDFTLFGILQGNAKTNWVLQIPIGLIWSVLYYIIFRWFITQFNVLTPGRGEEVDSKEISESADSTSNTADYLKQDSLQIIRALGGSNNIEDVDACVTRLRVAVKEVNQVDKALLKQIGAVDVLEVKGGIQAIYGAKAILYKNSINEILGVDD GT:EXON 1|1-505:0| BL:SWS:NREP 1 BL:SWS:REP 1->501|PTG3C_STAS1|2e-96|45.6|482/678| PROS 441->458|PS01035|PTS_EIIB_TYPE_1_CYS|PDOC00795| TM:NTM 9 TM:REGION 10->32| TM:REGION 54->76| TM:REGION 89->111| TM:REGION 113->134| TM:REGION 148->170| TM:REGION 193->215| TM:REGION 295->317| TM:REGION 323->345| TM:REGION 377->399| SEG 14->32|lpiailpaaglllgiggal| SEG 119->131|gvigalavgivav| BL:PDB:NREP 1 BL:PDB:REP 432->501|1o2fB|1e-06|31.4|70/77| RP:PDB:NREP 1 RP:PDB:REP 431->501|3bp8C|4e-18|43.7|71/75| RP:PFM:NREP 2 RP:PFM:REP 52->332|PF02378|6e-28|38.7|261/313|PTS_EIIC| RP:PFM:REP 431->463|PF00367|8e-08|54.5|33/35|PTS_EIIB| HM:PFM:NREP 2 HM:PFM:REP 9->332|PF02378|3.4e-77|36.8|304/321|PTS_EIIC| HM:PFM:REP 431->463|PF00367|6.3e-14|48.5|33/35|PTS_EIIB| GO:PFM:NREP 4 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF02378|IPR003352| GO:PFM GO:0008982|"GO:protein-N(PI)-phosphohistidine-sugar phosphotransferase activity"|PF02378|IPR003352| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF02378|IPR003352| GO:PFM GO:0016020|"GO:membrane"|PF02378|IPR003352| RP:SCP:NREP 1 RP:SCP:REP 431->501|3bp8C1|2e-18|43.7|71/75|d.95.1.1| HM:SCP:REP 427->503|1o2fB_|4.6e-18|36.4|77/0|d.95.1.1|1/1|Glucose permease domain IIB| OP:NHOMO 888 OP:NHOMOORG 347 OP:PATTERN -------------------------------------------------------------------- ----11------1------------1-----------122-------1--1---1--------2111232-----1------1-----------------------------------------------------------------------------------------------------1-----2-133333333333333336344343331121145------122555555555555553334531--11--1-242--131-1------111122211122222122222111111111111112211-2221---477777777373-7--244411-2-212-----1------111--12---122---------------------------------------------------------------------------------------------------------------------1--------111111111111111111111111--1------------------------2----------------------------------------------------------------------1--556-------31111112-111111--111-------11-11157232733445555544-4334546445455543443766431232422232232223222444344442-433222332333--1-------------------3------1--2------------11111111-------------------45552222233622-----------------2------33233333-------1---61311111-43131---------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 15.0 SQ:SECSTR #########################################################################################################################################################################################################################################################################################################################################################################################################################################cccHHHHHHHTTcTTTEEEEccccccEEEEEccGGGccHHHHHHHTcccEEEETTEEEEcccTTHHHHHHHHHHHT#### DISOP:02AL 408-427,503-506| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcccccEEEcHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHcccEEEEEEEcHHHccHHHHHHccccEEEEEccEEEEEEcccHHHHHHHHHHHHcccc //