[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56606.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   44->93 PF05440 * MtrB 0.00014 31.2 48/97  
:HMM:PFM   11->24 PF00309 * Sigma54_AID 0.0003 35.7 14/49  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56606.1 GT:GENE ACF56606.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1634544..1634852) GB:FROM 1634544 GB:TO 1634852 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE contains potential frameshift GB:PROTEIN_ID ACF56606.1 GB:DB_XREF GI:194358158 LENGTH 102 SQ:AASEQ MKRLISANPSEILQMNAEELKQSILASEGRVVLSENVVTRETFVGDITNSEIARAFGADMILLNCVDVFEPKIYALDSSGDDVIHRLTPACCLSNWCKFGTD GT:EXON 1|1-102:0| HM:PFM:NREP 2 HM:PFM:REP 44->93|PF05440|0.00014|31.2|48/97|MtrB| HM:PFM:REP 11->24|PF00309|0.0003|35.7|14/49|Sigma54_AID| OP:NHOMO 34 OP:NHOMOORG 34 OP:PATTERN ----------------1--------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-----------------------111--11--1-1----11-------------111------11111-11-------------1-------------------------------------1--------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----111--------------------------------1------------------------------------------1---------------------------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 102-103| PSIPRED ccEEEcccHHHHHcccHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHcHHHHHHHHHHHccHHHHHHccccHHHHHHHcHHHHHHHHHHHccc //