[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56614.1
DDBJ      :             LysM domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.7.1
:195 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   24->77 2djpA PDBj 2e-11 20.4 %
:RPS:SCOP  31->77 1e0gA  d.7.1.1 * 8e-10 28.9 %
:HMM:SCOP  31->80 1e0gA_ d.7.1.1 * 1.7e-09 39.6 %
:HMM:PFM   35->77 PF01476 * LysM 2.3e-15 42.9 42/44  
:BLT:SWISS 32->77 XLYA_BACSU 9e-07 47.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56614.1 GT:GENE ACF56614.1 GT:PRODUCT LysM domain protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 106372..106959 GB:FROM 106372 GB:TO 106959 GB:DIRECTION + GB:PRODUCT LysM domain protein GB:NOTE identified by match to protein family HMM PF01476 GB:PROTEIN_ID ACF56614.1 GB:DB_XREF GI:194358166 LENGTH 195 SQ:AASEQ MKSITKKIKATLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLSEIAETHNTTVEKLAENNHIDNIHLIYVDQELVIDGPVAPVATPAPATYAAPAAQDETVSAPVAETPVVSETVVSTVSGSEAEAKEWIAQKESGGSYTATNGRYIGRYQLTDSYLNGDYSAENQERVADAYVAGRYGSWTAAKNFWLNNGWY GT:EXON 1|1-195:0| BL:SWS:NREP 1 BL:SWS:REP 32->77|XLYA_BACSU|9e-07|47.8|46/297| TM:NTM 1 TM:REGION 9->31| SEG 10->23|atlagvaalfavfa| SEG 80->97|pvapvatpapatyaapaa| SEG 106->127|vaetpvvsetvvstvsgseaea| RP:PDB:NREP 1 RP:PDB:REP 24->77|2djpA|2e-11|20.4|54/77| HM:PFM:NREP 1 HM:PFM:REP 35->77|PF01476|2.3e-15|42.9|42/44|LysM| RP:SCP:NREP 1 RP:SCP:REP 31->77|1e0gA|8e-10|28.9|45/48|d.7.1.1| HM:SCP:REP 31->80|1e0gA_|1.7e-09|39.6|48/48|d.7.1.1|1/1|LysM domain| OP:NHOMO 67 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1242--222324433--231--1---111----11111111111111--------------11111111---------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 54 STR:RPRED 27.7 SQ:SECSTR #######################ccccccEEEEEEcccTTccHHHHHHHHTccHHHHHHHHTccccccGGGcccEEE###################################################################################################################### DISOP:02AL 1-5,84-132| PSIPRED cccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEcccccHHHHHHHHcccHHHHHHHcccccccEEEcccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccEEccccEEEEEEEEcccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHcccc //