Streptococcus pneumoniae G54 (spne4)
Gene : ACF56618.1
DDBJ      :             conserved hypothetical protein

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:42 amino acids

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56618.1 GT:GENE ACF56618.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(459585..459713) GB:FROM 459585 GB:TO 459713 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56618.1 GB:DB_XREF GI:194358170 LENGTH 42 SQ:AASEQ MKIKNTPQLKELPPVTNFEKNGSRAKKRSKIGSIRIVKIRLA GT:EXON 1|1-42:0| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11---1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,19-30| PSIPRED cccccccHHHccccccccccccHHHHHHcccccEEEEEEEEc //