[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56623.1
DDBJ      :             Glutathione S-transferase family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  360/915 : Eukaryota  99/199 : Viruses  0/175   --->[See Alignment]
a.45.1c.47.1
:263 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->260 3c8eB PDBj 5e-76 57.0 %
:RPS:PDB   4->256 3c8eA PDBj 1e-41 54.4 %
:RPS:SCOP  24->128 1eemA2  c.47.1.5 * 1e-11 22.6 %
:RPS:SCOP  130->256 1gsqA1  a.45.1.1 * 1e-16 11.7 %
:HMM:SCOP  28->133 1k0dD2 c.47.1.5 * 7.2e-16 38.4 %
:HMM:SCOP  122->256 1nhyA1 a.45.1.1 * 1.5e-30 40.5 %
:RPS:PFM   180->248 PF00043 * GST_C 4e-05 44.6 %
:HMM:PFM   180->249 PF00043 * GST_C 2.1e-11 34.4 64/95  
:HMM:PFM   76->125 PF02798 * GST_N 1e-07 39.1 46/75  
:BLT:SWISS 2->260 YGHU_ECOLI 1e-75 56.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56623.1 GT:GENE ACF56623.1 GT:PRODUCT Glutathione S-transferase family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1423113..1423904) GB:FROM 1423113 GB:TO 1423904 GB:DIRECTION - GB:PRODUCT Glutathione S-transferase family protein GB:NOTE identified by match to protein family HMM PF00043 GB:PROTEIN_ID ACF56623.1 GB:DB_XREF GI:194358175 LENGTH 263 SQ:AASEQ MSAYQLPTVWQDEASNQGAFTGLNRPTAGARFEQNLPKGEQAFQLYSLGTPNGVKVTILLEELLEAGFKEAAYDLYKIAIMDGDQFGSDFVKLNPNSKIPALLDQSGTENVRVFESAHILLYLAEKFGAFLPSNPVEKVEVLNWLFWQAGAAPFLGGGFGHFFNYAPEKLEYPINRFTMEVKRQLDLLDKELAQKPYIAGNDYTIADIAIWSWYGQLVQGNLYQGSAKFLDASSYQNLVKWAEKIANRPAVKRGLEVTYTEIK GT:EXON 1|1-263:0| BL:SWS:NREP 1 BL:SWS:REP 2->260|YGHU_ECOLI|1e-75|56.6|258/288| SEG 149->163|agaapflgggfghff| BL:PDB:NREP 1 BL:PDB:REP 4->260|3c8eB|5e-76|57.0|256/283| RP:PDB:NREP 1 RP:PDB:REP 4->256|3c8eA|1e-41|54.4|252/284| RP:PFM:NREP 1 RP:PFM:REP 180->248|PF00043|4e-05|44.6|56/98|GST_C| HM:PFM:NREP 2 HM:PFM:REP 180->249|PF00043|2.1e-11|34.4|64/95|GST_C| HM:PFM:REP 76->125|PF02798|1e-07|39.1|46/75|GST_N| RP:SCP:NREP 2 RP:SCP:REP 24->128|1eemA2|1e-11|22.6|93/98|c.47.1.5| RP:SCP:REP 130->256|1gsqA1|1e-16|11.7|120/127|a.45.1.1| HM:SCP:REP 28->133|1k0dD2|7.2e-16|38.4|99/102|c.47.1.5|1/1|Thioredoxin-like| HM:SCP:REP 122->256|1nhyA1|1.5e-30|40.5|126/144|a.45.1.1|1/1|Glutathione S-transferase (GST), C-terminal domain| OP:NHOMO 976 OP:NHOMOORG 459 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------1---------------------------------------------------------------631222-----------1-132131---------1-----------------------------------------------------------------------------------------------------1---11111111111111-------------1111111111-----------------------------------------------------4331-----215443313223322222222221-23422325244-211232245332262123311111132--------143-1121-----------------------------11143-222192444423233333843333335232333-122212212236231121----31---------112-2---------------------------13---------------------------1-211212212111111122211111112112---111-------121113-2222223222-2222222222222222222222333312212222222222222222222221-111111111111---1-----1111-1112111------------32333122212-44543435233332222-----------33111111112111311111111--------111111------------------------------------------------- ----67------111466324545544-1----3332212222---34374374222432224121111311222111-112223322-9G262-11111313--1-1-2---------------------------------------------------------311-----1--1----111--23-311----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 257 STR:RPRED 97.7 SQ:SECSTR ###ccccccccccTTcccTTTTTcccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHTTcGGGcEEEEEccGGGTGGGcHHHHHHcTTccccEEEETTccccEEEEcHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHTcccccHHHHHHHHHHHHHHHHHHHHHHTTcccTTcccccHHHHHHTTTHHHHHHTccTTccTTTTTGGGcHHHHHHHHHHHTcHHHHHHTTHTcc### DISOP:02AL 1-2,14-23,28-37,259-264| PSIPRED ccccccccEEEcccccccccccccccccccccHHccccccccEEEEEccccHHHHHHHHHHHHHHHHHcccccEEEEccccccccccHHHHHHcccccccEEEEccccccEEEEcHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHHHHHHHHHHHccccccccHHHcHHHHHHHHHHHccHHHHHHHHccHHHcc //