[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56627.1
DDBJ      :             glycerate kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  434/915 : Eukaryota  31/199 : Viruses  0/175   --->[See Alignment]
c.141.1
:371 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->371 1to6A PDBj e-180 88.9 %
:RPS:PDB   1->331 3cwcB PDBj 5e-48 37.9 %
:RPS:SCOP  1->371 1to6A  c.141.1.1 * 2e-94 86.0 %
:HMM:SCOP  1->371 1to6A_ c.141.1.1 * 2.9e-131 44.7 %
:RPS:PFM   1->366 PF02595 * Gly_kinase 5e-73 44.8 %
:HMM:PFM   1->367 PF02595 * Gly_kinase 9.9e-102 44.4 367/378  
:BLT:SWISS 1->371 GLXK_NEIMA e-180 88.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56627.1 GT:GENE ACF56627.1 GT:PRODUCT glycerate kinase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1005067..1006182 GB:FROM 1005067 GB:TO 1006182 GB:DIRECTION + GB:PRODUCT glycerate kinase GB:NOTE identified by match to protein family HMM PF02595; match to protein family HMM TIGR00045 GB:PROTEIN_ID ACF56627.1 GB:DB_XREF GI:194358179 LENGTH 371 SQ:AASEQ MKIVIAPDSFKESLTAQQVAEAIKRGFQQSIADVECLLCPVGDGGEGTVDAIRHSLDLKEKWIQVTDPFGQKEAMRYFQKGELALFEVADLVGLGKIPLEKRNPLQIQTCGIGELILHLISKGIKDIYIGVGGTASNDGGLGIAAGLGYQFYDRDGNVLPASGQSLLNLASVSTENRYKIPEGVQIHILADVVSPLCGYQGATYTFGNQKGLHPTMFAVVDQAIQDFYEKFSPATLEIKGAGAGGGLAGGLCAFAQASIVSGIDTCLDLINFDKKVSDADLVVVGEGRLDSQSFAGKAPIGVAKRTPVGVPVIAICGSLAEDLPPLPFENIQAVFSILEKSEPLEDSLKNASLYLERTAANIGHLLNMCKI GT:EXON 1|1-371:0| BL:SWS:NREP 1 BL:SWS:REP 1->371|GLXK_NEIMA|e-180|88.9|371/371| SEG 240->251|gagaggglaggl| BL:PDB:NREP 1 BL:PDB:REP 1->371|1to6A|e-180|88.9|371/371| RP:PDB:NREP 1 RP:PDB:REP 1->331|3cwcB|5e-48|37.9|327/367| RP:PFM:NREP 1 RP:PFM:REP 1->366|PF02595|5e-73|44.8|366/376|Gly_kinase| HM:PFM:NREP 1 HM:PFM:REP 1->367|PF02595|9.9e-102|44.4|367/378|Gly_kinase| GO:PFM:NREP 2 GO:PFM GO:0008887|"GO:glycerate kinase activity"|PF02595|IPR004381| GO:PFM GO:0031388|"GO:organic acid phosphorylation"|PF02595|IPR004381| RP:SCP:NREP 1 RP:SCP:REP 1->371|1to6A|2e-94|86.0|371/371|c.141.1.1| HM:SCP:REP 1->371|1to6A_|2.9e-131|44.7|371/371|c.141.1.1|1/1|Glycerate kinase I| OP:NHOMO 603 OP:NHOMOORG 465 OP:PATTERN -------------------------------------------------------------------- ---12-12222-11-11-------11-----1-1112142-1-11121-1113421-1--111111211211---111---1--------11-111--------1--1-1------------------------1------------------11---------1-------------------------111111313111121221111-111121111121112222111-22222222222222222221111--111111111--111--111-111----11111121111111111111111111111111111111--1111111-111111--1111-11111-11-11----11111-111----------------------------------------------------------------------1----------------11---------------------------------------111-11111211111111112222212111--1----------1----------------111111--------------1---------1---11----11---11------------------------111-1-----111111-1111111111111-------------21111212222232322-222232222222222222132411111433432432344344411111111--111111111111---------------11-111111-111--111-1111-11111-1111111111111-111-----1---111111111111212--11111111-------1--------------1---------------------------------------- ----11-------1-11-11-1----11111-1---1111111-------1111-11-----------------------------------1--------------1-1-----------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 371 STR:RPRED 100.0 SQ:SECSTR cEEEEcccccTTcccHHHHHHHHHHHHHTTcTTcEEEEcccccccTTHHHHHHHHTTcEEEEEEEEcTTccEEEEEEcTTccEEEEETHHHHcGGGccGGGccTTTcccHHHHHHHHHHHHTTccEEEEEccccccccTTHHHHHHTTcEEEcTTcccccccHHHHTTccEEEcTTccTHHHHcEEEEEcccccccccTTcHHHHHTGGGTccHHHHHHHHHHHHHHHHHHHHHTccccTTTTGGGGHHHHHHHHccEEEcHHHHHHHHTTHHHHHHTccEEEEcccccccTTcccHHHHHHHHHHTTTccEEEEEEEcccccccEEEEEEcEEEEEEcccTTcTTHHHHHHHHHHHHHHHHHHHHHcccc PSIPRED cEEEEEcccccccccHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHcccEEEEEEEEcccccEEEEEEEEcccEEEEEEHHHccccccccccccccccccccHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHccEEEcccccccccccHHHHHEEEEcHHHccccHHccEEEEEEccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccEEEcHHHHHHHHHcHHHHHccccEEEEcccccccccccccHHHHHHHHccccccEEEEEEEEcccccHHHHccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //