[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56631.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.29.8
:98 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  6->98 1tdpA_ a.29.8.1 * 0.00013 30.1 %
:HMM:PFM   7->73 PF08951 * EntA_Immun 2.7e-09 26.9 67/75  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56631.1 GT:GENE ACF56631.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1686560..1686856) GB:FROM 1686560 GB:TO 1686856 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF08957 GB:PROTEIN_ID ACF56631.1 GB:DB_XREF GI:194358183 LENGTH 98 SQ:AASEQ MVEPNLESLIKDLYNHARHDLSEDLVAALLETAKKLPTTNEQLQAVRLSGLVNRELLLNPKHPAPELLNLARFIKREEAKYRGTATSALMYEELFKML GT:EXON 1|1-98:0| HM:PFM:NREP 1 HM:PFM:REP 7->73|PF08951|2.7e-09|26.9|67/75|EntA_Immun| HM:SCP:REP 6->98|1tdpA_|0.00013|30.1|93/0|a.29.8.1|1/1|Bacteriocin immunity protein-like| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //