[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56636.1
DDBJ      :             ABC transporter, ATP-binding protein
Swiss-Prot:PSTB3_STRR6  RecName: Full=Phosphate import ATP-binding protein pstB 3;         EC=3.6.3.27;AltName: Full=Phosphate-transporting ATPase 3;AltName: Full=ABC phosphate transporter 3;

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:250 amino acids
:PSIPRED
:BLT:PDB   6->249 2oukB PDBj 2e-36 38.6 %
:RPS:PDB   5->237 3b5jA PDBj 9e-46 28.4 %
:RPS:SCOP  5->249 1b0uA  c.37.1.12 * 2e-44 38.8 %
:HMM:SCOP  1->245 1xew.1 c.37.1.12 * 1.6e-59 29.5 %
:RPS:PFM   81->175 PF00005 * ABC_tran 4e-13 47.1 %
:RPS:PFM   147->211 PF02463 * SMC_N 2e-05 32.3 %
:HMM:PFM   61->175 PF00005 * ABC_tran 5.1e-21 32.0 103/118  
:HMM:PFM   17->53 PF03193 * DUF258 5.3e-06 27.8 36/161  
:BLT:SWISS 1->250 PSTB3_STRR6 e-142 98.8 %
:PROS 147->161|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56636.1 GT:GENE ACF56636.1 GT:PRODUCT ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1911473..1912225 GB:FROM 1911473 GB:TO 1912225 GB:DIRECTION + GB:PRODUCT ABC transporter, ATP-binding protein GB:NOTE identified by match to protein family HMM PF00005; match to protein family HMM TIGR00972 GB:PROTEIN_ID ACF56636.1 GB:DB_XREF GI:194358188 LENGTH 250 SQ:AASEQ MGTFSVRHLDLFYGDFQALKNISIQLPERQITALIGPSGCGKSXFLKTLNRMNDLVPSCHIEGQVLLDEQDIYSSKFNLNQLRKRVGMVFQQPNPFAMSIYDNVAYGPRTHGIRDKKQLDALVEKSLKGAAIWDEVKDDLKKSAMSLSGGQQQRLCIARALAVEPDVLLMDEPTSALDPISTLKIEDLIQQLKKDYTIIIVTHNMQQASRISDKTAFFLTGEICEFGDTVDVFTNPKDQRTEDYISGRFG GT:EXON 1|1-250:0| SW:ID PSTB3_STRR6 SW:DE RecName: Full=Phosphate import ATP-binding protein pstB 3; EC=3.6.3.27;AltName: Full=Phosphate-transporting ATPase 3;AltName: Full=ABC phosphate transporter 3; SW:GN Name=pstB3; OrderedLocusNames=spr1898; SW:KW ATP-binding; Cell membrane; Complete proteome; Hydrolase; Membrane;Nucleotide-binding; Phosphate transport; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->250|PSTB3_STRR6|e-142|98.8|250/250| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006817|"GO:phosphate transport"|Phosphate transport| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 147->161|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 6->249|2oukB|2e-36|38.6|233/241| RP:PDB:NREP 1 RP:PDB:REP 5->237|3b5jA|9e-46|28.4|225/243| RP:PFM:NREP 2 RP:PFM:REP 81->175|PF00005|4e-13|47.1|85/123|ABC_tran| RP:PFM:REP 147->211|PF02463|2e-05|32.3|65/536|SMC_N| HM:PFM:NREP 2 HM:PFM:REP 61->175|PF00005|5.1e-21|32.0|103/118|ABC_tran| HM:PFM:REP 17->53|PF03193|5.3e-06|27.8|36/161|DUF258| GO:PFM:NREP 4 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| GO:PFM GO:0005524|"GO:ATP binding"|PF02463|IPR003395| GO:PFM GO:0005694|"GO:chromosome"|PF02463|IPR003395| RP:SCP:NREP 1 RP:SCP:REP 5->249|1b0uA|2e-44|38.8|237/258|c.37.1.12| HM:SCP:REP 1->245|1xew.1|1.6e-59|29.5|237/0|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 47600 OP:NHOMOORG 1174 OP:PATTERN UUIAQJIHVTTQUPXPgGLPIOHXtORhnQcSGCDDFBHGGFDTaSVjLS**i9SZRRWMSKLEY189 SZhG*WXYpptSUNTOOMM-Md88T*MMMMMLnfegf***LxQ*g*nXigYPuysKNfABmtjg*cu***aaXXXxebdO*hgDCEBDRRNH6LDGJ--DHSLKIZJUNP7877778CCBBBBBGSQLRYMNTTZQfnnvxLKJ*TuhiscclVeUVKHKELFegVi***ZKPILIJHPILFHaTWHFtnBSYv************************bnt**gmtvxust**VkkjljhgiillkiiccXYc*jZb**aPeYmusOP**eXRYllijlsruvtr**yyvzuuspvzsvudeaZcedgidccc*ssgfhttvnp***********f*lx***clki*tl***hpQK**qiUbhpTXngrrRfYSNaPTTJJLKIOWT***USj****************-ik*fa*f***SB**************HJIx*********RQRRRRRRmSVIOhT*55546555658888BC88A9AA88A8594JDDEBG***********vrrtn****ytvvZz******yAMrqpsdmot******ameNUKPgQGHFFIGFRQJZgeaz*TiUriUerZZmKcYWSUYhTbNTPQipVyOJJRHLIKOIECBEDEEEEEJPHHKJHnluOkObITKwSWXZVOSaUUTVRWaXXcZ5-DIUOK331433*u**W*vy***z***wx-*yxy*y*y*****vwxvvu*****iihnnjklmmmmmkkmkkk*soptssvV4************34JIDFCDENOQOKH*k*abYZbXLPTMMUOTfOPRQPGPFNPnZrrosr***s**uwf***EEECDHEDEJbpo*pqqqq**z**LMQLMMLLMLCBAB57IXPPIJKK88797999*9bECCDG-DDGEKIDPONCJNDIGBBBckvXXo*pomFYM 4655iXI-hL7AbjUFEODIKNLaLZNHGEFDFONLCMHKKIIDDFMJLXPLdSHHMGGGGHEBE68B2897BBFBB29A6997797A-JX9EGKICABHB98OOI5Jao*VfYnaqMIHGJXNtwC*E**n2qWvMKKEiHL*YFOLJEcJC*IWRSsMi*RvTUJ*Zg*jgqcAFKH*DFDJHmij*G*uKM*ilmJ ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ PSIPRED ccEEEEEEEEEEEccEEEEEcEEEEEccccEEEEEccccccHHHHHHHHHHccccccccEEEEEEEEccEEcccccccHHHHHHHccEEEEccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHcccHHHcccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHHHHHcc //