[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56637.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:WHIA_STRR6   RecName: Full=Putative sporulation transcription regulator whiA;

Homologs  Archaea  0/68 : Bacteria  241/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.95.2
:303 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   81->301 3hyiA PDBj 1e-23 32.2 %
:RPS:PDB   58->303 1dq3A PDBj 3e-17 11.5 %
:RPS:SCOP  122->195 1b24A2  d.95.2.1 * 2e-10 15.9 %
:HMM:SCOP  110->218 1dq3A4 d.95.2.2 * 1.8e-18 35.6 %
:RPS:PFM   21->99 PF10298 * WhiA_N 3e-08 34.2 %
:RPS:PFM   114->301 PF02650 * HTH_WhiA 2e-50 51.3 %
:HMM:PFM   112->301 PF02650 * HTH_WhiA 4e-69 48.7 189/191  
:HMM:PFM   19->99 PF10298 * WhiA_N 7.7e-29 40.7 81/86  
:BLT:SWISS 1->303 WHIA_STRR6 e-158 99.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56637.1 GT:GENE ACF56637.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1437787..1438698) GB:FROM 1437787 GB:TO 1438698 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF02650; match to protein family HMM TIGR00647 GB:PROTEIN_ID ACF56637.1 GB:DB_XREF GI:194358189 LENGTH 303 SQ:AASEQ MSFTVAVKEEILGQHHLSWHELSAIIKMSGSIGLSTSGLTLSVVTENAKLARHLYESFLHFYEIKSEIRHHQRSNLRKNRVYTVFTDEKVQDLLSDLHLADSFFGLETGIDEAILSDEEAGRAYLCGAFLANGSIRDPESGKYQLEISSVYLDHAQGIASLLQQFLLDAKVLERKKGAVTYLQRAEDIMDFLIVIGAMQARDDFERVKILRETRNDLNRANNAETANIARTVSASMKTINNISKIKDIMGLENLPVDLQEVAQLRIQHPDYSIQQLADSLSTPLTKSGVXHRLRKINKIADEL GT:EXON 1|1-303:0| SW:ID WHIA_STRR6 SW:DE RecName: Full=Putative sporulation transcription regulator whiA; SW:GN Name=whiA; OrderedLocusNames=spr1422; SW:KW Complete proteome; DNA-binding; Transcription;Transcription regulation. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->303|WHIA_STRR6|e-158|99.7|303/303| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| SEG 29->45|sgsiglstsgltlsvvt| BL:PDB:NREP 1 BL:PDB:REP 81->301|3hyiA|1e-23|32.2|211/284| RP:PDB:NREP 1 RP:PDB:REP 58->303|1dq3A|3e-17|11.5|235/454| RP:PFM:NREP 2 RP:PFM:REP 21->99|PF10298|3e-08|34.2|79/86|WhiA_N| RP:PFM:REP 114->301|PF02650|2e-50|51.3|187/190|HTH_WhiA| HM:PFM:NREP 2 HM:PFM:REP 112->301|PF02650|4e-69|48.7|189/191|HTH_WhiA| HM:PFM:REP 19->99|PF10298|7.7e-29|40.7|81/86|WhiA_N| RP:SCP:NREP 1 RP:SCP:REP 122->195|1b24A2|2e-10|15.9|69/79|d.95.2.1| HM:SCP:REP 110->218|1dq3A4|1.8e-18|35.6|104/109|d.95.2.2|1/1|Homing endonucleases| OP:NHOMO 241 OP:NHOMOORG 241 OP:PATTERN -------------------------------------------------------------------- ----11111111-1----------------------1------------111---11------111---1-11111111111-------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1-1111111----111111111111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 258 STR:RPRED 85.1 SQ:SECSTR #############################################ccHHHHcccEEcHHHHHHHHHHHHHccccccEEccccEEEEEccHHHHHHHHHHHTTGGTTGcccHHHHTTcHHHHHHHHHHHHHHHcEEETTEETTTEEEEEEccHHHHHHHHHHHHTTTcccEEEEEEcccEEEEccHHHHHHHHHHTGGGTTcccHHHHHHHHHHHHcccccccEEcccHHHHHHHHHTTTcEEEEETGTEEEEEETTEEEEcTTHHHHccEEHHHHHHHTTHHHHHHHHccHHHHHHHHHHHHc PSIPRED ccccHHHHHHHHccccccHHHHHHHHHHcccEEEEccEEEEEEEEccHHHHHHHHHHHHHHcccccEEEEEcccccccccEEEEEEEccHHHHHHHcccccccccccccccHHHcccHHHHHHHHHHHHHHcccccccccccEEEEEEEccHHHHHHHHHHHHHcccccEEEEEccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccHHHHHHHHHHHHcHHccHHHHHHHHcccccHHHHHHHHHHHHHHHHcc //