[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56649.1
DDBJ      :             glycosyl transferase, group 1 family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.56.2c.87.1
:184 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   16->167 3cx3B PDBj 1e-05 13.7 %
:RPS:SCOP  10->95 1ybfA  c.56.2.1 * 2e-04 17.3 %
:RPS:SCOP  110->178 2bisA1  c.87.1.8 * 8e-04 20.3 %
:HMM:SCOP  28->181 2bisA1 c.87.1.8 * 8e-09 18.4 %
:HMM:PFM   104->142 PF08323 * Glyco_transf_5 7.5e-07 41.0 39/241  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56649.1 GT:GENE ACF56649.1 GT:PRODUCT glycosyl transferase, group 1 family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 137637..138191 GB:FROM 137637 GB:TO 138191 GB:DIRECTION + GB:PRODUCT glycosyl transferase, group 1 family protein GB:NOTE contains potential frameshift GB:PROTEIN_ID ACF56649.1 GB:DB_XREF GI:194358201 LENGTH 184 SQ:AASEQ MQYSCGKININIPDGYGDIKDIVFSAHIIVRYNNGHCGGIDPHIIGLCKKQIRRMSLYPILIIVSRDSKVIDDYKNLDIAYVDCTQCSNNFETALHVKNILKLLKIQLIHCHGYSTNYFLYMLKKLDKNGFGKVKTVITCHGWVEYNLKKKFLTYFDFWTYSMGDAFICVSETMKKKIGEYNKK GT:EXON 1|1-184:0| SEG 98->109|knilkllkiqli| RP:PDB:NREP 1 RP:PDB:REP 16->167|3cx3B|1e-05|13.7|146/255| HM:PFM:NREP 1 HM:PFM:REP 104->142|PF08323|7.5e-07|41.0|39/241|Glyco_transf_5| RP:SCP:NREP 2 RP:SCP:REP 10->95|1ybfA|2e-04|17.3|75/240|c.56.2.1| RP:SCP:REP 110->178|2bisA1|8e-04|20.3|64/437|c.87.1.8| HM:SCP:REP 28->181|2bisA1|8e-09|18.4|147/0|c.87.1.8|1/1|UDP-Glycosyltransferase/glycogen phosphorylase| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 160 STR:RPRED 87.0 SQ:SECSTR ###############HHHHHHHHGGcEEEcc######ccccTTTccccHHHHHHHHHccEEEEccTTGTcccTTTTccccEETcccccccccccccGGGcHHHHHHHHHcTTEEHHHHHHHHHHHHHHHHTTTccEEEEcccccHHHHHHTTcEEEEcccccTTcccEEccHHHHHHHHHH### DISOP:02AL 1-3,178-185| PSIPRED ccccccEEEEEccccccHHHHEEEEEEEEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEEcccccccHHcccEEEEEEHHHcccccHHHHHHHHHHHHHEEEEEEEEcccHHHHHHHHHHHccccccEEEEEEEEEEEEEEcHHHHHHHHHHHEEEEcccEEEEEHHHHHHHHHHHccc //