[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56653.1
DDBJ      :             MutT/nudix family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->70 3hhjB PDBj 5e-06 47.2 %
:RPS:PDB   18->139 3dupB PDBj 7e-14 11.7 %
:RPS:SCOP  13->139 1sjyA  d.113.1.1 * 1e-15 19.4 %
:HMM:SCOP  7->139 1vcdA1 d.113.1.1 * 5.5e-21 26.2 %
:RPS:PFM   9->69 PF00293 * NUDIX 4e-05 29.5 %
:HMM:PFM   13->122 PF00293 * NUDIX 1.3e-19 25.7 109/135  
:BLT:SWISS 20->70 MUTT_STRAM 2e-06 55.6 %
:PROS 43->64|PS00893|NUDIX_BOX

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56653.1 GT:GENE ACF56653.1 GT:PRODUCT MutT/nudix family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1614685..1615113) GB:FROM 1614685 GB:TO 1615113 GB:DIRECTION - GB:PRODUCT MutT/nudix family protein GB:NOTE identified by match to protein family HMM PF00293 GB:PROTEIN_ID ACF56653.1 GB:DB_XREF GI:194358205 LENGTH 142 SQ:AASEQ MELEISDFPGCKIALFCGDKLLTILRDDKASIPWANMWELPGGGREGDESPFECVAREVYEELGIHLTEDCXLWSKVYPSMLFADKQSVFLVGQLTQNQFDSXVFGDEGQGYQLMNVEEFLSSSQVVPQLQERLKDYLKVSD GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 20->70|MUTT_STRAM|2e-06|55.6|45/154| PROS 43->64|PS00893|NUDIX_BOX|PDOC00695| BL:PDB:NREP 1 BL:PDB:REP 35->70|3hhjB|5e-06|47.2|36/131| RP:PDB:NREP 1 RP:PDB:REP 18->139|3dupB|7e-14|11.7|120/277| RP:PFM:NREP 1 RP:PFM:REP 9->69|PF00293|4e-05|29.5|61/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 13->122|PF00293|1.3e-19|25.7|109/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 13->139|1sjyA|1e-15|19.4|124/154|d.113.1.1| HM:SCP:REP 7->139|1vcdA1|5.5e-21|26.2|122/0|d.113.1.1|1/1|Nudix| OP:NHOMO 36 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------111-11-1--1111111-111------------11--111---------------------------------------------------------------------------------------------1---------------------------11-----11-----------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------1111-----------------------------------12------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 93.0 SQ:SECSTR #######HEEEEEEEEEcEEEEEEEcTTccEcccTTcEEEEEEEccTTccHHHHHHHHHHHHHcccHHHHTTcEEEEEEEEEEETTEEEEEEEEEEEccTTcccccTTccEEEEEEHHHHHHcccccTTHHHHHHHHHH### DISOP:02AL 1-3,142-143| PSIPRED cccccccccEEEEEEEEccEEEEEEccccccccccccEEcccccccccccHHHHHHHHHHHHcccEEEccEEEEEEEEEccccccEEEEEEEEEEcccccccccccccccEEEEccHHHHHHcccccHHHHHHHHHHHHccc //