[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56662.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:40 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->27 PF04588 * HIG_1_N 0.00014 47.4 19/54  
:HMM:PFM   23->34 PF00779 * BTK 0.00067 50.0 12/32  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56662.1 GT:GENE ACF56662.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1368407..1368529) GB:FROM 1368407 GB:TO 1368529 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE identified by glimmer; putative GB:PROTEIN_ID ACF56662.1 GB:DB_XREF GI:194358214 LENGTH 40 SQ:AASEQ MTLLSPMIVIVLSAILYSMKIKGQTKKLAAGCSKHSFEVV GT:EXON 1|1-40:0| TM:NTM 1 TM:REGION 1->20| HM:PFM:NREP 2 HM:PFM:REP 8->27|PF04588|0.00014|47.4|19/54|HIG_1_N| HM:PFM:REP 23->34|PF00779|0.00067|50.0|12/32|BTK| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11--111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccc //