[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56663.1
DDBJ      :             rRNA/tRNA methylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  157/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.79.3
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->53 1ipaA PDBj 2e-05 42.0 %
:RPS:SCOP  4->93 1ipaA2  d.79.3.3 * 6e-18 34.4 %
:HMM:SCOP  2->94 1ipaA2 d.79.3.3 * 4.2e-21 36.6 %
:HMM:PFM   29->93 PF08032 * SpoU_sub_bind 2.3e-15 36.9 65/76  
:BLT:SWISS 1->117 YSGA_BACSU 3e-13 40.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56663.1 GT:GENE ACF56663.1 GT:PRODUCT rRNA/tRNA methylase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1789548..1789940) GB:FROM 1789548 GB:TO 1789940 GB:DIRECTION - GB:PRODUCT rRNA/tRNA methylase GB:NOTE contains potential frameshift; identified by match to protein family HMM PF08032 GB:PROTEIN_ID ACF56663.1 GB:DB_XREF GI:194358215 LENGTH 130 SQ:AASEQ MTIITSKANSVVKNAKKLHQKKYRKSAYLIEGWHLFEEAVQAGVTIEKIFALENYRDQLAAFPQTVWISEDILLDLADSQTPQGIVAVVQKEEVGQADLSQGKFLFLEDVQDPGNVGLSFELRMQQVLQE GT:EXON 1|1-130:0| BL:SWS:NREP 1 BL:SWS:REP 1->117|YSGA_BACSU|3e-13|40.0|115/248| BL:PDB:NREP 1 BL:PDB:REP 4->53|1ipaA|2e-05|42.0|50/258| HM:PFM:NREP 1 HM:PFM:REP 29->93|PF08032|2.3e-15|36.9|65/76|SpoU_sub_bind| RP:SCP:NREP 1 RP:SCP:REP 4->93|1ipaA2|6e-18|34.4|90/100|d.79.3.3| HM:SCP:REP 2->94|1ipaA2|4.2e-21|36.6|93/105|d.79.3.3|1/1|L30e-like| OP:NHOMO 158 OP:NHOMOORG 157 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------1-------------------------11------------1--1111---------1-111----------------------111111111111111111111-11111---11-1-----1-1111111111111111--1-111111111-111111111-1111111111111111111111111-111111111111111111111111---1111111111111------11-1-1--1-1111--1---1--------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------1--------------------------------------------------------------------1-1--------1---1---------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 50 STR:RPRED 38.5 SQ:SECSTR ###EccTTcHHHHHHHGGGcHHHHHHHEEEEcHHHHHHHHHTTccEEEEEEET############################################################################# DISOP:02AL 1-1| PSIPRED ccEEEccccHHHHHHHHHHHHHHHccEEEEEcHHHHHHHHHccccEEEEEEcHHHHHHHccccEEEEEcHHHHHHHHccccccEEEEEEccccccccccccccEEEEEccccccHHHHHHHHcHHHHccc //