[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56671.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  214/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.72.2
:447 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->211 1gqyB PDBj 3e-06 28.0 %
:RPS:PDB   41->436 2am1A PDBj 5e-31 15.2 %
:RPS:SCOP  1->295 1fgsA2  c.72.2.2 * 2e-22 20.1 %
:HMM:SCOP  37->299 1p3dA3 c.72.2.1 * 3.6e-33 31.2 %
:RPS:PFM   53->170 PF08245 * Mur_ligase_M 2e-10 33.6 %
:RPS:PFM   319->429 PF08353 * DUF1727 8e-27 49.5 %
:HMM:PFM   319->429 PF08353 * DUF1727 4.9e-37 40.5 111/113  
:HMM:PFM   53->281 PF08245 * Mur_ligase_M 2.8e-20 28.1 178/188  
:BLT:SWISS 39->294 MURC_MARMS 9e-10 29.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56671.1 GT:GENE ACF56671.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1458565..1459908 GB:FROM 1458565 GB:TO 1459908 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF08245; match to protein family HMM PF08353 GB:PROTEIN_ID ACF56671.1 GB:DB_XREF GI:194358223 LENGTH 447 SQ:AASEQ MNLKTTLGLLAGRSSHFVLSRLGRGSTLPGKVALQFDKDILQNLAKNYEIVVVTGTNGKTLTTALTVGILKEVYGQVLTNPSGANMITGIATTFLTAKSSKTGKNIAVLEIDEASLSRICDYIQPSLFVITNIFRDQMDRFGEIYTTYNMILDAIRKVPTATVLLNGDSPLFYKPTIPNPIEYFGFDLEKGPAQLAHYNTEGILCPDCQGILKYEHNTYANLGAYICEGCGCKRPDLDYRLTKLVELTNNRSRFVIDGQEYGIQIGGLYNIYNALAAVAIARFLGADSQLIKQGFDKSRAVFGRQETFHIGDKKCTLVLIKNPVGATQAIEMIKLAPYPFSLSVLLNANYADGIDTSWIWDADFEQITDMDIPEINAGGVRHSEIARRLRVTGYPAEKITETSNLEQVLKTIENQDCKHAYILATYTAMLEFRELLASRQIVRKEMN GT:EXON 1|1-447:0| BL:SWS:NREP 1 BL:SWS:REP 39->294|MURC_MARMS|9e-10|29.4|204/473| BL:PDB:NREP 1 BL:PDB:REP 51->211|1gqyB|3e-06|28.0|150/469| RP:PDB:NREP 1 RP:PDB:REP 41->436|2am1A|5e-31|15.2|341/442| RP:PFM:NREP 2 RP:PFM:REP 53->170|PF08245|2e-10|33.6|116/187|Mur_ligase_M| RP:PFM:REP 319->429|PF08353|8e-27|49.5|111/111|DUF1727| HM:PFM:NREP 2 HM:PFM:REP 319->429|PF08353|4.9e-37|40.5|111/113|DUF1727| HM:PFM:REP 53->281|PF08245|2.8e-20|28.1|178/188|Mur_ligase_M| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF08245|IPR013221| GO:PFM GO:0009058|"GO:biosynthetic process"|PF08245|IPR013221| RP:SCP:NREP 1 RP:SCP:REP 1->295|1fgsA2|2e-22|20.1|264/282|c.72.2.2| HM:SCP:REP 37->299|1p3dA3|3.6e-33|31.2|205/215|c.72.2.1|1/1|MurD-like peptide ligases, catalytic domain| OP:NHOMO 219 OP:NHOMOORG 217 OP:PATTERN --------------------------------12-------------------2-------------- ---1-11111111111-11-111111111111111111111111-----1111111--1111-11-1111111111111-111-----------------------------------------------------11111---11-11-111----------11--111------------------11-1-----------------------------------------11111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111--1111111111111-111111-111-1--11111111--111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 406 STR:RPRED 90.8 SQ:SECSTR ########################################HHHHHHccEEEEEEcccccccHHHHHHHHTTTccccccEEEccTTcccTTHHHHHHHTcTTccEEEEEccccTTHHHHHHHHHcccEEEEccccccccTTcccHHHHHHHHGGGTTcccTTcEEEEEccGHGGGGGcccccEEEEEcTTcccEEEEEEccccEEEEETTcccEEEEcccGTTccGGGccHHHHHHHHHHHHHHHcccTTcccEEEEEccEEEEEcccHHHHHHHHHHHHHHHHTTccHHHHHHHGGGcccccccccEEccTTTcEEEEcccccHHHHHHHHHHTTcccccccEEEEEEEcccccTTHHHHHHHGGGccTTTccEEEEEEcTTHHHHHHHHHcEEEEEccccccTHHHHHHHHHHHccTTEEEEccccHHHHHHHHHHHHHHHTHHH# DISOP:02AL 1-1,447-448| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHccccEEEcccccccccccHHHHHHHcccccccEEEEEEcccccHHHHHHHcccEEEEEEcccHHHHHHcccHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHccccEEEEEccccccHHHHHHHHcccccccccccEEEEcccEEcccccccccccccccccccEEEEEEEEEccccEEEEEcccEEEEEcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEEcccEEEEEcccccHHHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHcccccccEEEEccHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHcccccccccc //