[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56672.1
DDBJ      :             PTS system,  IIB component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.44.2
:101 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->96 3czcA PDBj 1e-09 23.0 %
:RPS:SCOP  1->97 1vkrA  c.44.2.1 * 2e-04 20.9 %
:HMM:SCOP  1->101 1vkrA_ c.44.2.1 * 1e-10 26.6 %
:HMM:PFM   3->55 PF02302 * PTS_IIB 1.4e-10 25.0 52/90  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56672.1 GT:GENE ACF56672.1 GT:PRODUCT PTS system, IIB component GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 574668..574973 GB:FROM 574668 GB:TO 574973 GB:DIRECTION + GB:PRODUCT PTS system, IIB component GB:PROTEIN_ID ACF56672.1 GB:DB_XREF GI:194358224 LENGTH 101 SQ:AASEQ MIKILAACGAGVNSSHQIKSALXEELSNRGYDVHCDAVMVKDVNEDLMKGYDIFTPIAATDLGFEPGIPVIEAGPILFRIPAMSAPVFDNIESAIKEHELS GT:EXON 1|1-101:0| RP:PDB:NREP 1 RP:PDB:REP 1->96|3czcA|1e-09|23.0|87/89| HM:PFM:NREP 1 HM:PFM:REP 3->55|PF02302|1.4e-10|25.0|52/90|PTS_IIB| RP:SCP:NREP 1 RP:SCP:REP 1->97|1vkrA|2e-04|20.9|91/97|c.44.2.1| HM:SCP:REP 1->101|1vkrA_|1e-10|26.6|94/0|c.44.2.1|1/1|PTS system, Lactose/Cellobiose specific IIB subunit| OP:NHOMO 46 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11--1-------1---------1111---1--222222212221111111111111---------1---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 86.1 SQ:SECSTR cEEEEEEccccHHHHHHHHHHHHHHTTcc##cEEEEEEcHHHH#HHHGGGccEEETTTGGGTTTccccEEEEEccT######cHHHHHHHHHHHHc##### DISOP:02AL 96-102| PSIPRED ccHHHHHHccccccHHHHHHHHHHHHHHcccEEEEEEEEEEcccHHHHcccccEEEHHHHcccccccccEEEcccEEEEccccccHHHHHHHHHHHHcccc //