[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56675.1
DDBJ      :             preprotein translocase subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   23->87 PF02699 * YajC 1e-07 45.2 %
:HMM:PFM   11->90 PF02699 * YajC 1.5e-23 39.0 77/83  
:BLT:SWISS 11->88 Y1254_AQUAE 7e-08 36.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56675.1 GT:GENE ACF56675.1 GT:PRODUCT preprotein translocase subunit GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 286451..286744 GB:FROM 286451 GB:TO 286744 GB:DIRECTION + GB:PRODUCT preprotein translocase subunit GB:NOTE identified by match to protein family HMM PF02699; match to protein family HMM TIGR00739 GB:PROTEIN_ID ACF56675.1 GB:DB_XREF GI:194358227 LENGTH 97 SQ:AASEQ MDTTLFYGIVIVLAVSPLLLSSFHSIRQQKLLRKQMEQRQEYLASLTSGDEVLLLSGIHGKIISIKDDLISLQIAKGVVIYVEKESVMGKTKELLFK GT:EXON 1|1-97:0| BL:SWS:NREP 1 BL:SWS:REP 11->88|Y1254_AQUAE|7e-08|36.0|75/102| TM:NTM 1 TM:REGION 3->25| RP:PFM:NREP 1 RP:PFM:REP 23->87|PF02699|1e-07|45.2|62/82|YajC| HM:PFM:NREP 1 HM:PFM:REP 11->90|PF02699|1.5e-23|39.0|77/83|YajC| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--------------11---111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,29-44| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccEEEEcccEEEEEEEEEccEEEEEEccccEEEEEEHHHHHHHHHHHcc //