[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56680.1
DDBJ      :             cytoplasmic membrane protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  471/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.29.9
:186 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->148 2etdA PDBj 1e-14 42.1 %
:RPS:SCOP  23->168 2etdA1  a.29.9.1 * 1e-43 41.9 %
:HMM:SCOP  23->171 2etdA1 a.29.9.1 * 1.3e-53 54.4 %
:RPS:PFM   4->178 PF04011 * LemA 3e-49 50.9 %
:HMM:PFM   3->181 PF04011 * LemA 1.9e-69 50.3 179/186  
:BLT:SWISS 26->181 Y1576_METJA 1e-28 39.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56680.1 GT:GENE ACF56680.1 GT:PRODUCT cytoplasmic membrane protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1153633..1154193) GB:FROM 1153633 GB:TO 1154193 GB:DIRECTION - GB:PRODUCT cytoplasmic membrane protein GB:NOTE identified by match to protein family HMM PF04011 GB:PROTEIN_ID ACF56680.1 GB:DB_XREF GI:194358232 LENGTH 186 SQ:AASEQ MTWIILGVLALVVIFVIVSYNGLVKNRMQTKEAWSQIDVQLKRRNDLLPNLIETVKGYAKYEGSTLEKVAELRNQVAAATSPAEAMKASDALTRQVSGIFAVAESYPDLKASANFVKLQEELTNTENKISYSRQLYNSVVSNYNVKLETFPSNIIAGMFGFKAADFLQTPEEEKSVPKVDFSGLGD GT:EXON 1|1-186:0| BL:SWS:NREP 1 BL:SWS:REP 26->181|Y1576_METJA|1e-28|39.1|156/189| TM:NTM 1 TM:REGION 2->24| BL:PDB:NREP 1 BL:PDB:REP 29->148|2etdA|1e-14|42.1|114/128| RP:PFM:NREP 1 RP:PFM:REP 4->178|PF04011|3e-49|50.9|175/184|LemA| HM:PFM:NREP 1 HM:PFM:REP 3->181|PF04011|1.9e-69|50.3|179/186|LemA| RP:SCP:NREP 1 RP:SCP:REP 23->168|2etdA1|1e-43|41.9|136/139|a.29.9.1| HM:SCP:REP 23->171|2etdA1|1.3e-53|54.4|149/0|a.29.9.1|1/1|LemA-like| OP:NHOMO 568 OP:NHOMOORG 481 OP:PATTERN ------------------------1-------21--1------11-11--1-1--------------- 111--------1--1------1---1------1111---------1-1-111------11--1--------111111111111-----2241-111---11421112111--------------111111111--1-----222--1--111-----------------1--1-----1---------112------------------1-------------11111111--1--------------1----11111111111111111111111---1111222111111111111111111111111111111111111111--11111111-1---11-----1-21-----22---1--1-22121112--111211111112222121222311111111111-1111111111--111-1111111111111-----------------------2--------------------------------21211111111------1111---11111111211211--2211113113211-22112211--------2111211-11--11-2-----21221112-2222-11-121-1-----------------1-1--111-11-1---1-111--211111122111--211-1---------------11-111---1---1-11--111-----1-1--12-2---------------------------11111111111---11111111111211-1111111-------12222211121112212-3111----2---111111111-----------1-111111111111----11--11--11--------111-------1-111-1111-1--111112-1111111-3- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 61.3 SQ:SECSTR ############################HHHHHHHHHHHHHHHHHHHHHHHHHHH#HHcTTc#HHHHHHHHHHHHHHc##cHHHHHHHHHHHHHHHHHHHHHHTTcHHH#HcHHHHHH#HHHHHHHHHHHHHHHHHHHHHHHHHHccc###################################### DISOP:02AL 72-96,184-187| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHcccccccccccc //