[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56684.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y1989_STRPI  RecName: Full=UPF0161 protein SPH_1989;

Homologs  Archaea  0/68 : Bacteria  606/915 : Eukaryota  17/199 : Viruses  0/175   --->[See Alignment]
:80 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->67 PF01809 * DUF37 4e-18 60.6 %
:HMM:PFM   1->67 PF01809 * DUF37 9.1e-34 59.7 67/68  
:BLT:SWISS 1->80 Y1989_STRPI 9e-46 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56684.1 GT:GENE ACF56684.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1693407..1693649) GB:FROM 1693407 GB:TO 1693649 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF01809; match to protein family HMM TIGR00278 GB:PROTEIN_ID ACF56684.1 GB:DB_XREF GI:194358236 LENGTH 80 SQ:AASEQ MKRILIAPVRFYQRFISPVFPPSCRFELTCSNYMIQAIEKHGFKGVLMGLARILRCHPWSKTGKDPVPDHFSLKRNQEGE GT:EXON 1|1-80:0| SW:ID Y1989_STRPI SW:DE RecName: Full=UPF0161 protein SPH_1989; SW:GN OrderedLocusNames=SPH_1989; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->80|Y1989_STRPI|9e-46|100.0|80/80| RP:PFM:NREP 1 RP:PFM:REP 2->67|PF01809|4e-18|60.6|66/68|DUF37| HM:PFM:NREP 1 HM:PFM:REP 1->67|PF01809|9.1e-34|59.7|67/68|DUF37| OP:NHOMO 638 OP:NHOMOORG 623 OP:PATTERN -------------------------------------------------------------------- 111-1--1-1-1-1-1112-11--111111111111-1111---11111111111-11---1111111111----1-11111111111111111111--111111111-1--------------11111111111111111---1131111111111111111111111111111111111111111111-1111111111111111111122111-111-111111111111-111111111111-1111111-111111111111-11111---1111111111111111111111111111111111111---1111111111111111111-1-111111111-11-1-11-1-1--111111111-1211------1-111------------11111111111-----------1-------------11---1111111111--------1-1-11-1------------1111--111-111-----1111-111111111111111111111111111111111-----111111111111111111111111111111111-111-1111-1111---111111111111-1--------------------------11111-1111111111111111111111-1111-1-1-11-------11-1-1---11---1--11---1111-111111111----111--11--1---1-1-1-11-1---11-----111-1-11--11-----111-11--11111-1-11111111111111111--111111-1-11-1-11111----1---1----1-1-1--1--1111-11-1--1-11111111111--------1---------------------------111-111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------4---111-1511-11-121-1111----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 69-81| PSIPRED cHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHccccccccccccccccccccccccc //