[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56693.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->36 PF06305 * DUF1049 0.00036 25.8 31/80  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56693.1 GT:GENE ACF56693.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1945732..1946046) GB:FROM 1945732 GB:TO 1946046 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56693.1 GB:DB_XREF GI:194358245 LENGTH 104 SQ:AASEQ MWVLGFILFMIFFYSNNSKKIKKLENKIKKLERKEKGNAEMSRLLQEMIGKEPIITGVYIGPDNWEVVDVDEEWVKLRSVDNTGKEKFKLQRIEDIQTVEFDGE GT:EXON 1|1-104:0| COIL:NAA 29 COIL:NSEG 1 COIL:REGION 19->47| SEG 15->36|snnskkikklenkikklerkek| SEG 65->75|wevvdvdeewv| HM:PFM:NREP 1 HM:PFM:REP 5->36|PF06305|0.00036|25.8|31/80|DUF1049| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 21-41,103-105| PSIPRED cHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccEEEEEEEccccEEEEEEcHHHHHHHHHcccccEEEEEEEEEEEEEEEcccc //