[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56694.1
DDBJ      :             PTS system, IIBCA components
Swiss-Prot:PTG3C_STRPN  RecName: Full=PTS system glucose-specific EIICBA component;AltName: Full=EIICBA-Glc;AltName: Full=EII-Glc/EIII-Glc;Includes:  RecName: Full=Glucose permease IIC component;  AltName: Full=PTS system glucose-specific EIIC component;Includes:  RecName: Full=Glucose-specific phosphotransferase enzyme IIB component;           EC=2.7.1.69;  AltName: Full=PTS system glucose-specific EIIB component;Includes:  RecName: Full=Glucose-specific phosphotransferase enzyme IIA component;           EC=2.7.1.-;  AltName: Full=PTS system glucose-specific EIIA component;

Homologs  Archaea  0/68 : Bacteria  401/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.84.3d.95.1
:495 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   245->318 1o2fB PDBj 7e-06 31.5 %
:BLT:PDB   348->491 2gprA PDBj 9e-32 43.4 %
:RPS:PDB   245->318 3bp8C PDBj 3e-19 45.2 %
:RPS:PDB   337->494 1ax3A PDBj 3e-20 38.6 %
:RPS:SCOP  245->318 3bp8C1  d.95.1.1 * 1e-19 45.2 %
:RPS:SCOP  346->494 1f3gA  b.84.3.1 * 9e-37 38.3 %
:HMM:SCOP  243->319 1o2fB_ d.95.1.1 * 1.6e-18 36.8 %
:HMM:SCOP  340->494 2gprA_ b.84.3.1 * 4.6e-54 44.8 %
:RPS:PFM   1->151 PF02378 * PTS_EIIC 1e-13 40.7 %
:RPS:PFM   245->278 PF00367 * PTS_EIIB 5e-05 52.9 %
:RPS:PFM   347->475 PF00358 * PTS_EIIA_1 9e-41 58.9 %
:HMM:PFM   347->475 PF00358 * PTS_EIIA_1 2.4e-50 50.4 129/133  
:HMM:PFM   2->151 PF02378 * PTS_EIIC 1.9e-17 33.9 115/321  
:HMM:PFM   245->278 PF00367 * PTS_EIIB 3.7e-16 50.0 34/35  
:BLT:SWISS 1->495 PTG3C_STRPN 0.0 99.8 %
:PROS 411->423|PS00371|PTS_EIIA_TYPE_1_HIS
:PROS 257->274|PS01035|PTS_EIIB_TYPE_1_CYS
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56694.1 GT:GENE ACF56694.1 GT:PRODUCT PTS system, IIBCA components GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 672079..673566 GB:FROM 672079 GB:TO 673566 GB:DIRECTION + GB:PRODUCT PTS system, IIBCA components GB:NOTE contains potential frameshift; identified by match to protein family HMM PF00358; match to protein family HMM PF00367; match to protein family HMM TIGR00826; match to protein family HMM TIGR00830 GB:PROTEIN_ID ACF56694.1 GB:DB_XREF GI:194358246 LENGTH 495 SQ:AASEQ MYGTLERLLLPFGLHHMLTIPMNYTALGGTYDILTGAAKGTQVFGQDPLWLAWVTDLVNLKGTDASQYQHLLDTVHPARFKVGQMIGSFGILMGVIVAIYRNVDADKKHKYKGMMIATALATFLTGVTEPIEYMFMFIATPMYLVYSLVQGAAFAMADVVNLRMHSFGSIEFLTRTPIAISAGIGMDIVNFVWVTVLFAVIMYFIANFMIQKFNYATPGRNGNYETAEGSEETSSEVKVAAGSQAVNIINLLGGRVNIVDVDACMTRLRVTVKDADKVGNAEQWKAEGAMGLVMKGQGVQAIYGPKADILKSDIQDILDSGEIIPETLPSQMTEAQQNTVHFKDLTEEVYSVADGQVVALEQVKDPVFAQKMMGDGFAVEPANGNIVSPVSGTVSSIFPTKHAFGIVTEAGLEVLVHIGLDTVSLEGKPFTVHVAEGQKVAAGDLLVTADLDAIRAAGRETSTVVVFTNGDAIKSVKLEKTGSLAAKTAVAKVEL GT:EXON 1|1-495:0| SW:ID PTG3C_STRPN SW:DE RecName: Full=PTS system glucose-specific EIICBA component;AltName: Full=EIICBA-Glc;AltName: Full=EII-Glc/EIII-Glc;Includes: RecName: Full=Glucose permease IIC component; AltName: Full=PTS system glucose-specific EIIC component;Includes: RecName: Full=Glucose-specific phosphotransferase enzyme IIB component; EC=2.7.1.69; AltName: Full=PTS system glucose-specific EIIB component;Includes: RecName: Full=Glucose-specific phosphotransferase enzyme IIA component; EC=2.7.1.-; AltName: Full=PTS system glucose-specific EIIA component; SW:GN Name=exp5; OrderedLocusNames=SP_0758; SW:KW Cell membrane; Complete proteome; Kinase; Membrane;Phosphotransferase system; Sugar transport; Transferase;Transmembrane; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->495|PTG3C_STRPN|0.0|99.8|495/726| GO:SWS:NREP 8 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|Phosphotransferase system| GO:SWS GO:0008643|"GO:carbohydrate transport"|Sugar transport| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 411->423|PS00371|PTS_EIIA_TYPE_1_HIS|PDOC00528| PROS 257->274|PS01035|PTS_EIIB_TYPE_1_CYS|PDOC00795| TM:NTM 3 TM:REGION 81->103| TM:REGION 116->138| TM:REGION 183->205| SEG 225->236|etaegseetsse| BL:PDB:NREP 2 BL:PDB:REP 245->318|1o2fB|7e-06|31.5|73/77| BL:PDB:REP 348->491|2gprA|9e-32|43.4|143/154| RP:PDB:NREP 2 RP:PDB:REP 245->318|3bp8C|3e-19|45.2|73/75| RP:PDB:REP 337->494|1ax3A|3e-20|38.6|158/162| RP:PFM:NREP 3 RP:PFM:REP 1->151|PF02378|1e-13|40.7|118/313|PTS_EIIC| RP:PFM:REP 245->278|PF00367|5e-05|52.9|34/35|PTS_EIIB| RP:PFM:REP 347->475|PF00358|9e-41|58.9|129/132|PTS_EIIA_1| HM:PFM:NREP 3 HM:PFM:REP 347->475|PF00358|2.4e-50|50.4|129/133|PTS_EIIA_1| HM:PFM:REP 2->151|PF02378|1.9e-17|33.9|115/321|PTS_EIIC| HM:PFM:REP 245->278|PF00367|3.7e-16|50.0|34/35|PTS_EIIB| GO:PFM:NREP 8 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF02378|IPR003352| GO:PFM GO:0008982|"GO:protein-N(PI)-phosphohistidine-sugar phosphotransferase activity"|PF02378|IPR003352| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF02378|IPR003352| GO:PFM GO:0016020|"GO:membrane"|PF02378|IPR003352| GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF00358|IPR001127| GO:PFM GO:0006810|"GO:transport"|PF00358|IPR001127| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF00358|IPR001127| GO:PFM GO:0016020|"GO:membrane"|PF00358|IPR001127| RP:SCP:NREP 2 RP:SCP:REP 245->318|3bp8C1|1e-19|45.2|73/75|d.95.1.1| RP:SCP:REP 346->494|1f3gA|9e-37|38.3|149/150|b.84.3.1| HM:SCP:REP 243->319|1o2fB_|1.6e-18|36.8|76/0|d.95.1.1|1/1|Glucose permease domain IIB| HM:SCP:REP 340->494|2gprA_|4.6e-54|44.8|154/0|b.84.3.1|1/1|Duplicated hybrid motif| OP:NHOMO 1647 OP:NHOMOORG 403 OP:PATTERN -------------------------------------------------------------------- ----2311224-4------------2-----------333-----1-22-1--13--------522334311---3112---2-----------------------------------------------------------------------------------------------------1-----3-25444444455444444768887544223126924462523377777777777777433468A-4861265AIG227B32745232344455554445555545554544444444444444556635554---9HCCCDDBD4C4-J11255511-3-323-----1---1--322--24---244---------------------------------1-----------------------------------------------------------------------------------2--------222222222222222222222222--2-----1------------------4----------------------------------------------------------------------1--557-----1-42222223122222211222-------22-2226A663A45557577766-5556668657576565665998983453533343343334333654455663-644334443444--2---------------111342111112114------------22222323-------------------56663333344733-----------------4------33343434-------7---61411111155121---------------- -------------1-----------------------------------------------------------------------------------------------------------------------------------------------------3----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 252 STR:RPRED 50.9 SQ:SECSTR ##################################################################################################################################################################################################################################################ccHHHHHHHTTcTTTEEEEccHHHHHHHHHHccccccHHHHHHHHHcHHHHHHHHHHHHHHccGGGccHHHHHHcccTTcEEEEEEETTEEEEEccccccTTccccccccccEEEEEGGGcccHHHHTcTTcEEEEEEEcccEEEEcccEEEEEccccccEEEEEcccccEEEEEccccTTTTTTTTEEEccccccEEccEEEEEEEcHHHHGGGcccccEEEEEccGGGTcEEEEccccEcTTccccEEEE# DISOP:02AL 225-243,318-346| PSIPRED cHHHHHHHHHHHHHHHHHHHHEEEEEcccEEEEccccccccEEEccHHHHHccccccHHcccccccccccccccccHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHcccEEEEEEEEccccccHHHHHcccccEEEEEEccEEEEEEcccHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEcccEEEEEEHHHcccHHHcccccccEEEEEEcccEEEEEEEEEEEEEEccccEEEEEEccccEEEEEEccccccccccccEEEEccccEEEcccEEEEEcHHHHHHcccccEEEEEEccHHHEEEEEEccccEEEcccEEEEEEc //