[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56697.1
DDBJ      :             ribosomal protein L7A family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  136/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.79.3
:99 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->99 2zkr6 PDBj 2e-06 35.9 %
:RPS:PDB   8->99 3cpqA PDBj 3e-15 25.0 %
:RPS:SCOP  4->94 1h7mA  d.79.3.1 * 1e-14 25.3 %
:HMM:SCOP  5->98 1t0kB_ d.79.3.1 * 4.9e-23 43.6 %
:RPS:PFM   9->85 PF01248 * Ribosomal_L7Ae 7e-06 44.2 %
:HMM:PFM   4->93 PF01248 * Ribosomal_L7Ae 4.3e-19 34.4 90/95  
:BLT:SWISS 2->99 YLXQ_ENTFC 4e-25 50.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56697.1 GT:GENE ACF56697.1 GT:PRODUCT ribosomal protein L7A family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 486634..486933 GB:FROM 486634 GB:TO 486933 GB:DIRECTION + GB:PRODUCT ribosomal protein L7A family protein GB:NOTE identified by match to protein family HMM PF01248 GB:PROTEIN_ID ACF56697.1 GB:DB_XREF GI:194358249 LENGTH 99 SQ:AASEQ MNKQKMSNLLGLAQRAGRIISGEELVVKAIQDGKAKLVFLAHDAGPNLTKKIQDKSHYYQVEIVTVFSTLELSIAVGKSRKVLAVTDAGFTKKMRSLME GT:EXON 1|1-99:0| BL:SWS:NREP 1 BL:SWS:REP 2->99|YLXQ_ENTFC|4e-25|50.0|98/103| TM:NTM 1 TM:REGION 58->78| BL:PDB:NREP 1 BL:PDB:REP 4->99|2zkr6|2e-06|35.9|92/113| RP:PDB:NREP 1 RP:PDB:REP 8->99|3cpqA|3e-15|25.0|92/99| RP:PFM:NREP 1 RP:PFM:REP 9->85|PF01248|7e-06|44.2|77/93|Ribosomal_L7Ae| HM:PFM:NREP 1 HM:PFM:REP 4->93|PF01248|4.3e-19|34.4|90/95|Ribosomal_L7Ae| RP:SCP:NREP 1 RP:SCP:REP 4->94|1h7mA|1e-14|25.3|91/97|d.79.3.1| HM:SCP:REP 5->98|1t0kB_|4.9e-23|43.6|94/0|d.79.3.1|1/1|L30e-like| OP:NHOMO 136 OP:NHOMOORG 136 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111111111111111111111111111111-1-111111111-1111111111111111111111111111111111111111111111111-11-------------1------1-1---11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 100.0 SQ:SECSTR HHHccHHHHHHHHHHHcEEEEcHHHHHHHHHTTcccEEEEcTTccHHHHHHHHHHHHHTccEEEccccHHHHHHHTTcccccEEEEEcTTccHHHHHHc DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHccEEccHHHHHHHHHHccEEEEEEEccccHHHHHHHHHHHHHccccEEEcccHHHHHHHHcccEEEEEEEcccHHHHHHHHHc //