[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56704.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:59 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->41 PF10110 * GPDPase_memb 0.00037 17.6 34/149  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56704.1 GT:GENE ACF56704.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 164896..165075 GB:FROM 164896 GB:TO 165075 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56704.1 GB:DB_XREF GI:194358256 LENGTH 59 SQ:AASEQ MTLSVLSTTSKQCFELSAPSFLVCSLIFIEYTTILLPLARDFVYVEGLGSYVVELFCSF GT:EXON 1|1-59:0| TM:NTM 1 TM:REGION 17->39| HM:PFM:NREP 1 HM:PFM:REP 7->41|PF10110|0.00037|17.6|34/149|GPDPase_memb| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,3-3,6-6| PSIPRED cEEEEEEcccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcc //