[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56707.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.12
:289 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   85->196 1vbhA PDBj 3e-07 36.0 %
:RPS:PDB   2->254 1dikA PDBj 1e-27 19.4 %
:RPS:SCOP  60->254 1dikA1  c.1.12.2 * 9e-21 20.3 %
:HMM:SCOP  24->269 1h6zA1 c.1.12.2 * 1.2e-31 24.5 %
:RPS:PFM   89->229 PF02896 * PEP-utilizers_C 2e-09 27.9 %
:HMM:PFM   21->232 PF02896 * PEP-utilizers_C 5.4e-21 22.1 204/294  
:BLT:SWISS 24->229 PPSA_PYRHO 2e-16 26.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56707.1 GT:GENE ACF56707.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 702737..703606 GB:FROM 702737 GB:TO 703606 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE identified by match to protein family HMM PF02896 GB:PROTEIN_ID ACF56707.1 GB:DB_XREF GI:194358259 LENGTH 289 SQ:AASEQ MRNQLALSGEKILEKIYPQLFHHVGMIRGEYLLRELNQNIILASCQQFVKDYLETICSLYSDEEVWYRFTELTNTEANCLVGTKEFFDEGHPLFGYRGTRRLLACLDEFQAEAHVVTEVYQTNPNLSVIFPFVNDADQLKQAITALRQYGFTGKVGTMIELPSAYFDLSSILETGISKIVVGMNDLTSFVFATMRNSQWHDLESPIMLDMLRDMQDKARKNKINFAVAGYLNTSFIQKMNQLGIKCIIHYSSIPEIFDLEIDHPDHLKHIKEESKKLQRSTHDTARNVE GT:EXON 1|1-289:0| BL:SWS:NREP 1 BL:SWS:REP 24->229|PPSA_PYRHO|2e-16|26.4|201/821| BL:PDB:NREP 1 BL:PDB:REP 85->196|1vbhA|3e-07|36.0|111/862| RP:PDB:NREP 1 RP:PDB:REP 2->254|1dikA|1e-27|19.4|248/869| RP:PFM:NREP 1 RP:PFM:REP 89->229|PF02896|2e-09|27.9|140/300|PEP-utilizers_C| HM:PFM:NREP 1 HM:PFM:REP 21->232|PF02896|5.4e-21|22.1|204/294|PEP-utilizers_C| GO:PFM:NREP 2 GO:PFM GO:0016310|"GO:phosphorylation"|PF02896|IPR000121| GO:PFM GO:0016772|"GO:transferase activity, transferring phosphorus-containing groups"|PF02896|IPR000121| RP:SCP:NREP 1 RP:SCP:REP 60->254|1dikA1|9e-21|20.3|192/365|c.1.12.2| HM:SCP:REP 24->269|1h6zA1|1.2e-31|24.5|245/366|c.1.12.2|1/1|Phosphoenolpyruvate/pyruvate domain| OP:NHOMO 70 OP:NHOMOORG 68 OP:PATTERN ------1-1111111--------11--12-1111-111--111111111----11111111------- ---------------------1---------------1-----1----------------------11-------------------------------------------------------------------------111---111-------------------------------------------------------------------------------------------------------------------------------------------11111111111-------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------1----------------------------------------------------1-----------------------------------------------------1------------------------------------------------------1111------1---------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 289 STR:RPRED 100.0 SQ:SECSTR EEcTHHHHcHHHHHHHHHHHHcccHHHHHHHHHTTHHHHHEEHHHHHHHHHHTTEEEccccHHHHHcHHHHTTTccHHHHHHHHHTTccccTTccccTHHHHHHcHHHHHHHHHHHHTTccccGccEEEEcccccHHHHHHHHccccccccccEEEEEEccHHHHHTHHHHHHHccEEEEEEHHHHHHHHHTccHHHHHHHHHHTTHHHHHHHHHHHHHHHccEEEEEcTTcHHHHHHHHHHTccEEEcTTTHHHHHHHHHHHHHHHccccccTTcccTTccccHHHHH DISOP:02AL 289-290| PSIPRED cEEEEEcccHHHHHHHHHccccEEcHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHHHccEEEEcccHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHcccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //