[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56708.1
DDBJ      :             S1 RNA binding domain
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  683/915 : Eukaryota  137/199 : Viruses  0/175   --->[See Alignment]
a.294.1a.60.16a.60.2b.40.4c.55.3
:709 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->702 3bzkA PDBj e-143 45.3 %
:RPS:PDB   1->707 3bzcA PDBj e-122 43.4 %
:RPS:SCOP  2->303 2oceA3  a.294.1.1 * 1e-76 36.1 %
:RPS:SCOP  304->452 2oceA5  c.55.3.13 * 2e-37 59.2 %
:RPS:SCOP  437->543 3ci0K2  a.60.16.1 * 5e-19 8.7 %
:RPS:SCOP  544->614 2oceA2  a.60.2.6 * 6e-16 28.2 %
:RPS:SCOP  630->702 1sroA  b.40.4.5 * 4e-18 34.7 %
:HMM:SCOP  618->709 1wi5A_ b.40.4.5 * 4.1e-22 35.9 %
:RPS:PFM   8->190 PF09371 * Tex_N 2e-35 48.1 %
:RPS:PFM   631->701 PF00575 * S1 8e-10 42.3 %
:HMM:PFM   8->196 PF09371 * Tex_N 7.6e-65 50.3 189/193  
:HMM:PFM   633->702 PF00575 * S1 2.2e-17 41.4 70/74  
:HMM:PFM   475->527 PF03934 * GspK 0.001 21.2 52/280  
:BLT:SWISS 8->702 Y568_HAEIN e-150 45.6 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56708.1 GT:GENE ACF56708.1 GT:PRODUCT S1 RNA binding domain GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 809642..811771 GB:FROM 809642 GB:TO 811771 GB:DIRECTION + GB:PRODUCT S1 RNA binding domain GB:NOTE identified by similarity to GB:AAK99612.1; match to protein family HMM PF00575 GB:PROTEIN_ID ACF56708.1 GB:DB_XREF GI:194358260 LENGTH 709 SQ:AASEQ MDKKYEKISQDLGVTLKQIDTVLSLTAEGATIPFIARYRKDMTGSLDEVAIKAIIDLDKSLTNLNDRKEAVLAKIQEQGKLTKELEEAILVAEKLADVEELYLPYKEKRRTKATIAREAGLFPLARLILQNIVDLEKEAEKFVCEGFATGKEALTGAVDILVEALSEDVTLRSMTYQEVLRHSKLTSQAKDESLDEKQVFQIYYDFSETVGTMQGYRTLALNRGEKLGVLKIGFEHATDRILAFFATRFKVKNAYIDEVVQQSVKKKVLPAIERRIRTELTEKAEEGAIQLFSDNLRNLLLVAPLKGRVVLGFDPAFRTGAKLAVVDATGKMLTTQVIYPVKPASARQIEEAKKDLADLIGQYGVEIIAIGNGTASRESEAFVAEVLKDFPEVSYVIVNESGASVYSASELARQEFPDLTVEKRSAISIARRLQDPLAELVKIDPKSIGVGQYQHDVSQKKLSESLDFVVDTVVNQVGVNVNTASPALLSHVAGLNKTISENIVKYREEEGKITSRSQIKKVPRLGAKAFEQAAGFLRIPESSNILDNTGVHPENYAAVKELFKCLDIKDLNEEAQSKLKSLSVKEMAQELDLGPETLKDIIADLLKPGXDFRDSFDAPVLRQDVLDIKDLVVGKKLEGVVRXVVNFGAFVDIGIHEDGLIHISHMSRKFIKHPSQVVAVGDLVSVWVKKIDTEREKVNLSLLAPNETD GT:EXON 1|1-709:0| BL:SWS:NREP 1 BL:SWS:REP 8->702|Y568_HAEIN|e-150|45.6|689/762| COIL:NAA 18 COIL:NSEG 1 COIL:REGION 62->79| SEG 469->482|vvdtvvnqvgvnvn| BL:PDB:NREP 1 BL:PDB:REP 25->702|3bzkA|e-143|45.3|674/728| RP:PDB:NREP 1 RP:PDB:REP 1->707|3bzcA|e-122|43.4|705/730| RP:PFM:NREP 2 RP:PFM:REP 8->190|PF09371|2e-35|48.1|183/193|Tex_N| RP:PFM:REP 631->701|PF00575|8e-10|42.3|71/74|S1| HM:PFM:NREP 3 HM:PFM:REP 8->196|PF09371|7.6e-65|50.3|189/193|Tex_N| HM:PFM:REP 633->702|PF00575|2.2e-17|41.4|70/74|S1| HM:PFM:REP 475->527|PF03934|0.001|21.2|52/280|GspK| GO:PFM:NREP 1 GO:PFM GO:0003723|"GO:RNA binding"|PF00575|IPR003029| RP:SCP:NREP 5 RP:SCP:REP 2->303|2oceA3|1e-76|36.1|302/323|a.294.1.1| RP:SCP:REP 304->452|2oceA5|2e-37|59.2|147/149|c.55.3.13| RP:SCP:REP 437->543|3ci0K2|5e-19|8.7|103/110|a.60.16.1| RP:SCP:REP 544->614|2oceA2|6e-16|28.2|71/73|a.60.2.6| RP:SCP:REP 630->702|1sroA|4e-18|34.7|72/76|b.40.4.5| HM:SCP:REP 618->709|1wi5A_|4.1e-22|35.9|92/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1405 OP:NHOMOORG 827 OP:PATTERN --------------------------------11----11111------------------------- 1-1-211111111121111-12112211111222222211-222-----11-111---11111-12222211111111112-------2111-1-----1111--12211--------------1---------1-22233---3-111111--------------1111---------------------1122222222212222221122112221111222222222121222222222222221111221211113---22331123122-22222221222222222222222222112222222221122221112-1213222222212321221111222122112122221-21-122---112-41111-----112222112222211221121222-22222222221-222222222222221111-22222122-------------221------------------------------11111222222222222222222222222222221111-11112222222222211222112222222222222222212-221-11222-222232222----32-21-------------------1---1--2222222222222222222222222222221-2222-11111122222222222222222-222222222222222222222222222222222222222222222222222212222222222221122111112222222222222222221222221112111222222222222222222222211111111112222222222222222222222222222--1---------------111------11--1----------1111-1111------11 --------211---1---11111111-11111111-1111111111----111111-111111---------1-----------1-11-1-1-1--1111---111--4-32113212211221422412D2121322112122111212211212222221222423-2B4121--12A121--3111-21112---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 707 STR:RPRED 99.7 SQ:SECSTR cHHHHHHHHHHHTTcTTccHHHHHHHHTTccHHHHHHHcHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHcccHHHHHHHHGGGccccccHHHHHHHTTTHHHHHHHHcTTccHHHHHHTTcccccccHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHcEEEEEEcGGGcGGGGGGGGGcEEEEEGGGccHHHHHHHHTccccccEEEEEEcccccTTccccccccccHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccccccEEEEEccccccEEEEEEcTTccEEEEEEEcccGGGcTccHHHHHHHHHHHHHHHTccEEEEEccTTHHHHHHHHHHHHHHcGGcEEEEEccHHHHHHHHcHHHHHHcTTccHHHHHHHHHHHHHHcHHHHHTTccGGGGTccTTGGGccHHHHHHHHHHHHHHHHHHHcEETTTccHHHHHTcTTccHHHHHHHHHHHHHHcccccGGGGGGcTTccHHHHHHHGGGEEcTTcccGGGGccccGGGHHHHHHHHHHHTccHHHHTTcHHHHHHccGGGTccccccHHHHHHHHHHHHcTTccccccccTTTTcccccccTTccTTcccccEEEEEETTEEEEEcccccEEEEETTTccccccccHHHHccTTccccccEEEEETTTTEEEEccccccc## DISOP:02AL 1-2,189-194,409-416,705-710| PSIPRED cHHHHHHHHHHHcccHHHHHHHHHHHHccccccEEHHccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHccccccccHHHHHHHcccHHHHHHHHcccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcEEEEEEEEccccccccccHHHHHHHccHHHcccHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccccEEEEEEcccccEEEccEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccccEEEEccccccHHcccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccEEEcccHHHHccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHccccHHHHHHHHcHHEEEcccccccccccccHHHHHHHHHHHHHcccHHHcccHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEcccEEEEEccccccEEEHHHccccccccHHHHcccccEEEEEEEEEEccccEEEEEEEcccccc //