[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56716.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:44 amino acids
:PSIPRED
:HMM:PFM   11->42 PF12550 * GCR1_C 8.8e-05 21.9 32/81  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56716.1 GT:GENE ACF56716.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1950019..1950153) GB:FROM 1950019 GB:TO 1950153 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56716.1 GB:DB_XREF GI:194358268 LENGTH 44 SQ:AASEQ MINILYFLIILTIWQVFDEFSEKYDKMKKIRNQGEVYGADWKSL GT:EXON 1|1-44:0| TM:NTM 1 TM:REGION 1->23| HM:PFM:NREP 1 HM:PFM:REP 11->42|PF12550|8.8e-05|21.9|32/81|GCR1_C| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHcc //