[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56717.1
DDBJ      :             prephenate dehydratase
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  722/915 : Eukaryota  94/199 : Viruses  0/175   --->[See Alignment]
c.94.1d.58.18
:282 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->271 2qmxA PDBj 5e-32 34.9 %
:RPS:PDB   191->282 2dtjA PDBj 1e-10 13.0 %
:RPS:SCOP  2->180 2qmwA1  c.94.1.1 * 7e-51 33.1 %
:RPS:SCOP  191->269 2qmwA2  d.58.18.3 * 3e-13 34.6 %
:HMM:SCOP  173->273 1phzA1 d.58.18.3 * 5.3e-23 45.4 %
:RPS:PFM   3->179 PF00800 * PDT 2e-37 47.2 %
:RPS:PFM   198->259 PF01842 * ACT 6e-05 47.3 %
:HMM:PFM   3->180 PF00800 * PDT 7.5e-61 46.3 177/182  
:HMM:PFM   198->242 PF01842 * ACT 0.00016 31.8 44/66  
:BLT:SWISS 1->276 PHEA_LACLA 2e-81 51.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56717.1 GT:GENE ACF56717.1 GT:PRODUCT prephenate dehydratase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1276720..1277568) GB:FROM 1276720 GB:TO 1277568 GB:DIRECTION - GB:PRODUCT prephenate dehydratase GB:NOTE identified by match to protein family HMM PF00800 GB:PROTEIN_ID ACF56717.1 GB:DB_XREF GI:194358269 LENGTH 282 SQ:AASEQ MKIAYLGPKGSFSHHVVQTAFPHEELQAFANITDVIKAYEQGLVDYSVVPVENSIEGSVHETLDYLFHQAHIQAVAEIVQPIHQQLMVVPGHTKIEKIFSHPQALAQGKKFIDEQYPEAQIEVTASTAYAARFISEHPDQPFAAIAPRSSAEEYGLELIAEDIQEMEANFTRFWLLGAEKPSIPLQAQTEKMSLALTLPDNLPGALYKALSTFAWRGIDLTKIEXRPLKTALGEYFFIIDVDYTDKDLVHFAQKELEAIGIQYKIXGAYPIYPISDHGKERR GT:EXON 1|1-282:0| BL:SWS:NREP 1 BL:SWS:REP 1->276|PHEA_LACLA|2e-81|51.8|276/279| BL:PDB:NREP 1 BL:PDB:REP 3->271|2qmxA|5e-32|34.9|261/275| RP:PDB:NREP 1 RP:PDB:REP 191->282|2dtjA|1e-10|13.0|92/164| RP:PFM:NREP 2 RP:PFM:REP 3->179|PF00800|2e-37|47.2|176/181|PDT| RP:PFM:REP 198->259|PF01842|6e-05|47.3|55/65|ACT| HM:PFM:NREP 2 HM:PFM:REP 3->180|PF00800|7.5e-61|46.3|177/182|PDT| HM:PFM:REP 198->242|PF01842|0.00016|31.8|44/66|ACT| GO:PFM:NREP 4 GO:PFM GO:0004664|"GO:prephenate dehydratase activity"|PF00800|IPR001086| GO:PFM GO:0009094|"GO:L-phenylalanine biosynthetic process"|PF00800|IPR001086| GO:PFM GO:0008152|"GO:metabolic process"|PF01842|IPR002912| GO:PFM GO:0016597|"GO:amino acid binding"|PF01842|IPR002912| RP:SCP:NREP 2 RP:SCP:REP 2->180|2qmwA1|7e-51|33.1|172/184|c.94.1.1| RP:SCP:REP 191->269|2qmwA2|3e-13|34.6|78/80|d.58.18.3| HM:SCP:REP 173->273|1phzA1|5.3e-23|45.4|97/97|d.58.18.3|1/1|ACT-like| OP:NHOMO 948 OP:NHOMOORG 872 OP:PATTERN ---1--1111111111-1111111111111111111111111111111111111-1-----1111111 1111111111111111111-11111111111111111111122211111111222111--111-11111111---111-111111111111111---1-11111111111---------------1111111111111111222111111111111111111111111111111111111111111-111-11111111111111111111111111111111--11111112-11111111111111111111----------------------111-------11111111111111-------------121111111-11-11-------1-11111----1-1--111111111111--11111--11111111-11-1111111111111111111111111-11111111111-1111111111111111111111111111111111111111111-----------------------------11111-12221111111211111111111111111111111111111111121111111111111111111111111-1122111111111-1111111111111221211111111111-1-------1111111111111111111111111111111111111---111111111111111111111111111-1111111111111111111111111111111111111111111111111111-1--11111111111-1-----111-1121211111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111----------1---------------------------1--1-111111 ------1-----111-111-1-11211111111111111111111111111-1-111---11111-1-1----11---111111--11-1-11111111--1--11-23------------------------------------------------------------------1111D111-14685-731123221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 281 STR:RPRED 99.6 SQ:SECSTR #EEEEEccTTcHHHHHHHHHHHHcEEEEEccHHHHHHHHHTTcccEEEEEEEEccccccHHHHHHHHHcccEEEEEEEEEEcccEEEEccccTTTccEEEcHHHHHHTHHHHcccTTHHHHHHHTTTcEEEEEEEcccccTccEEEEEEEEEccccEEEEEEEEETTTTEEEEEEEEEEEcccEEEEEccEEEEEEEEEEccTTHHHHHHHHHHHTTccccEEEEccccTTTcEEEEEEEEEHHHHHHHHHHHHTTTTTTTccEEEEEccEEEEEEEEEccT DISOP:02AL 276-283| PSIPRED cEEEEEcccccHHHHHHHHHcccccEEEcccHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHcccccEEEEEEEEEEEEEEEEEEcccccEEEEEEEcHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHcccccEEEEccHHHHHHHccEEEEcccccccccEEEEEEEEcccccccccccccEEEEEEEEcccccHHHHHHHHHHHHcccccEEEEEEccccccccEEEEEEEcccccHHHHHHHHHHHHHccEEEEEEEEccEEEcccccccc //