[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56721.1
DDBJ      :             peptidase, M24 family
Swiss-Prot:             

Homologs  Archaea  66/68 : Bacteria  832/915 : Eukaryota  186/199 : Viruses  0/175   --->[See Alignment]
c.55.2d.127.1
:353 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->353 2zsgA PDBj 5e-71 39.1 %
:RPS:PDB   1->353 1chmA PDBj 8e-72 19.5 %
:RPS:SCOP  1->125 1chmA1  c.55.2.1 * 4e-20 16.0 %
:RPS:SCOP  128->348 1pv9A2  d.127.1.1 * 2e-56 44.3 %
:HMM:SCOP  8->127 1pv9A1 c.55.2.1 * 1.5e-32 35.7 %
:HMM:SCOP  126->353 1chmA2 d.127.1.1 * 2.1e-76 48.4 %
:RPS:PFM   4->125 PF01321 * Creatinase_N 4e-13 33.6 %
:RPS:PFM   134->336 PF00557 * Peptidase_M24 6e-34 37.6 %
:HMM:PFM   135->337 PF00557 * Peptidase_M24 2.6e-61 41.0 200/203  
:HMM:PFM   4->127 PF01321 * Creatinase_N 4e-29 33.1 124/131  
:BLT:SWISS 17->353 YQHT_BACSU 3e-65 41.1 %
:PROS 283->295|PS00491|PROLINE_PEPTIDASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56721.1 GT:GENE ACF56721.1 GT:PRODUCT peptidase, M24 family GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 179086..180147 GB:FROM 179086 GB:TO 180147 GB:DIRECTION + GB:PRODUCT peptidase, M24 family GB:NOTE identified by match to protein family HMM PF00557; match to protein family HMM PF01321 GB:PROTEIN_ID ACF56721.1 GB:DB_XREF GI:194358273 LENGTH 353 SQ:AASEQ MNKRVQAFLAKMQEKELDGIIINNLKNVYYLTGFWGSNGTVFISRDRQVLVTDSRYIIAAKQETSGFEIVADRDELAVIAGIVKDMNLTRIGFEDEISVSYYHRMQAAFAGLNLLPQTQFVEGLRMIKDEAEIAAIRKACSISDQAFRDALDFIKPGKTEIEIANFLDFRMRELGASGLSFDTILASGINSSKPHAHPMHKPVELGEAITMDFGCLYDHYVSDMTRTIYLGHVSDEQAEIYNTVLKANQALIDQAKAGLGFRDFDKIPRDIIIEAGYGDYFTHGIGHGIGLDIHEEPYFSQTSTETIKTGMALTDEPGIYIEGKYGVRIEDDILITETGCELLTLAPKELIVI GT:EXON 1|1-353:0| BL:SWS:NREP 1 BL:SWS:REP 17->353|YQHT_BACSU|3e-65|41.1|336/353| PROS 283->295|PS00491|PROLINE_PEPTIDASE|PDOC00417| SEG 283->290|hgighgig| BL:PDB:NREP 1 BL:PDB:REP 4->353|2zsgA|5e-71|39.1|348/356| RP:PDB:NREP 1 RP:PDB:REP 1->353|1chmA|8e-72|19.5|353/401| RP:PFM:NREP 2 RP:PFM:REP 4->125|PF01321|4e-13|33.6|122/130|Creatinase_N| RP:PFM:REP 134->336|PF00557|6e-34|37.6|202/203|Peptidase_M24| HM:PFM:NREP 2 HM:PFM:REP 135->337|PF00557|2.6e-61|41.0|200/203|Peptidase_M24| HM:PFM:REP 4->127|PF01321|4e-29|33.1|124/131|Creatinase_N| GO:PFM:NREP 2 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01321|IPR000587| GO:PFM GO:0009987|"GO:cellular process"|PF00557|IPR000994| RP:SCP:NREP 2 RP:SCP:REP 1->125|1chmA1|4e-20|16.0|125/155|c.55.2.1| RP:SCP:REP 128->348|1pv9A2|2e-56|44.3|221/221|d.127.1.1| HM:SCP:REP 8->127|1pv9A1|1.5e-32|35.7|115/0|c.55.2.1|1/1|Creatinase/prolidase N-terminal domain| HM:SCP:REP 126->353|1chmA2|2.1e-76|48.4|225/246|d.127.1.1|1/1|Creatinase/aminopeptidase| OP:NHOMO 2261 OP:NHOMOORG 1084 OP:PATTERN 11111122222222221222222112221131111111111111111111111-32332341112-11 2242422222222122222-221123222222222222221--------1111121-1-1312-32235411------11312111112222-2221---121211121112222222221111122112111221233232222222222221222222222222-322222222222222211232112222444445543555545242222556255442322222255222222222222222222222223233232322223312123222211221222222222222222222222222222222322222222142235556566242151143332121141211332211114311112212211112111111-1221111112111221221225-11111111591134422453323221112-33332133311111111---2111-11111---111111--11111111--111212221211122222222222222333333333221222-1111-11--112-3-111111111111221111111124212112221221133323232311-1-122111111111-11111111111111211222312423234111122411113143135---1111------31211112222222222-22222222222222222221111111112111111111111112222111111223233223333---1-----1111112321111111111-111122223111111122221112122241111---------211111111122211--11111111222211-2221111-1-111122-2-11-1-12111111111111111111121112121211 --11231-221133343424333342454433343432121113226556335443422344244322113133233323322322-2-565336544433138661433567555811-113253-5-5O3-433211-4225221-2331161333334534351356943441-2-R2132455553231112333 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 353 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHHHTTccEEEEccHHHHHHHHccccccTEEEEccccEEEEEEGGGTTHHHHHccccEEEEEcTTcTHHHHHHHHHcccEEEEcTTccHHHHHHHHHHcTTcEEEEcHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHccTTccHHHHHHHHHHHHHHHHHHHcccEEEEEEGGGGGcTTcccccccccTTcEEEEEEEcEETTEEccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHccTTccHHHHHHHHHHHHHHHTcGGGcccccccccccEETTEEcccTTccccccTTcEEEEccEEEETTcEEEEccEEEEEETTEEEEcccccccHHHH DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHccccEEEEccHHHHHHHcccccccEEEEEcccccEEEEEcHHHHHHHHHcccccEEEcccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHccccEEEEcHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccEEEEcccccccccccccccccccccEEEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccEEEEEccccccccccccccccEEcccEEEEEccccEEccccEEEEEEEEEEcccccEEccccccEEEEc //