[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56730.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:209 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->63 PF09622 * DUF2391 0.00034 24.5 53/267  
:BLT:SWISS 5->158 NU2M_APILI 5e-04 25.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56730.1 GT:GENE ACF56730.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1467447..1468076) GB:FROM 1467447 GB:TO 1468076 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56730.1 GB:DB_XREF GI:194358282 LENGTH 209 SQ:AASEQ MSKHYKLVFYSRIFLFLAAFTGVYLEITKHGGFGMLLYYTVLSNLLVTIFTLYLLKVMSRVGENWQRPSLLRLKGGVTMSIMITCVIYHFLLAPIATNFYTLENFLCHYIVPIWFLADTLFFDKQGQYKIWDPAVWTILPFLYMMFALFNGLVLKLNIPNAKDNPFPYFFLNVNKGWNVVFKWCLIIFVAYMVAGFIFYFIKQIKRKSS GT:EXON 1|1-209:0| BL:SWS:NREP 1 BL:SWS:REP 5->158|NU2M_APILI|5e-04|25.2|135/100| TM:NTM 5 TM:REGION 6->28| TM:REGION 36->58| TM:REGION 79->101| TM:REGION 135->157| TM:REGION 180->202| HM:PFM:NREP 1 HM:PFM:REP 11->63|PF09622|0.00034|24.5|53/267|DUF2391| OP:NHOMO 30 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111-------------122111111----------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,207-210| PSIPRED cccHHHHHHHHHHHHHHHHHHHHEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //