[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56734.1
DDBJ      :             Non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein
Swiss-Prot:             

Homologs  Archaea  46/68 : Bacteria  837/915 : Eukaryota  45/199 : Viruses  0/175   --->[See Alignment]
c.51.4
:323 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   122->312 1k7kA PDBj 6e-38 47.0 %
:RPS:PDB   123->317 2carA PDBj 4e-40 26.9 %
:RPS:SCOP  123->314 1k7kA  c.51.4.1 * 2e-60 44.2 %
:HMM:SCOP  121->317 1k7kA_ c.51.4.1 * 7.5e-60 53.8 %
:RPS:PFM   124->312 PF01725 * Ham1p_like 8e-48 53.8 %
:HMM:PFM   124->312 PF01725 * Ham1p_like 4e-65 53.2 186/189  
:BLT:SWISS 1->320 NTPA_STRT2 e-115 67.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56734.1 GT:GENE ACF56734.1 GT:PRODUCT Non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1697360..1698331) GB:FROM 1697360 GB:TO 1698331 GB:DIRECTION - GB:PRODUCT Non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family protein GB:NOTE identified by match to protein family HMM PF01725; match to protein family HMM TIGR00042 GB:PROTEIN_ID ACF56734.1 GB:DB_XREF GI:194358286 LENGTH 323 SQ:AASEQ MTNKIYEYKDDQDWYVGSYSIFGGVNSLSDYKTDFPLFEFSKIFGDEEYGFPLSVTVLRYGSTYRLFSFVVDMLNQEMGRNLEVIQRHGALLLVENGQLLYVELPKEGVNVHDFFETSKVRETLLIATRNEGKTKEFRAIFDKLGYDVENLNDYPDLPEVAETGMTFEENARLKAETISQLTGKMVLADDSGLKVDVLGGLPGVWSARFAGVGATDRENNSKLLHELAMVFELKDRSAQFHTTLVVASPNKESLVVEADWSGYINFEPKGENGFGYDPLFLVGETGESSAELTLEEKNSQSHRALAVKKLLEVFPSWQSKPSL GT:EXON 1|1-323:0| BL:SWS:NREP 1 BL:SWS:REP 1->320|NTPA_STRT2|e-115|67.0|315/324| BL:PDB:NREP 1 BL:PDB:REP 122->312|1k7kA|6e-38|47.0|183/205| RP:PDB:NREP 1 RP:PDB:REP 123->317|2carA|4e-40|26.9|182/196| RP:PFM:NREP 1 RP:PFM:REP 124->312|PF01725|8e-48|53.8|186/188|Ham1p_like| HM:PFM:NREP 1 HM:PFM:REP 124->312|PF01725|4e-65|53.2|186/189|Ham1p_like| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01725|IPR002637| RP:SCP:NREP 1 RP:SCP:REP 123->314|1k7kA|2e-60|44.2|190/207|c.51.4.1| HM:SCP:REP 121->317|1k7kA_|7.5e-60|53.8|195/209|c.51.4.1|1/1|ITPase-like| OP:NHOMO 964 OP:NHOMOORG 928 OP:PATTERN 1-1-111111111111--111111-11-----111-1-----1-111-1111111111111-11---1 1111111111111111111-111111111111111111111122111111111111111111111111111-1111111111-1111111111111---1111111111111111111111111111111111111111111111111111111111222222111111112222222222221111111111111111111111111112111111111111111111111111111111111111111111211111121212222111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111-1111111-----------------------------111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111-1-------1111111111111111111111111111111111111--11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111----1---1--------11------1111111111111 ----------1-111-------1-111----------111111-11--11--11--1-----1----------1---------------121-1-2111-11-----12----1----------1--1---------1------------------------1---1---1--1-1------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 203 STR:RPRED 62.8 SQ:SECSTR ##################################################################################################################ccHHHHHHEEEEEcccHHHHHHHHHHHcTTcccEEEccccEEccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEEEGGGTTcEETTHHHHHHHHTTHHHHHHHHHHTTTTccHccccEEEEEEEEEEEccccccEEEEEEEEEEEcccccccTTcTTGGGEEETTccccTTTccHHHHHHHcHHHHHHHHHHHHHccc###### DISOP:02AL 1-2,321-324| PSIPRED ccccEEEEEccccEEEEEEEEcccccccccccccHHHHHHHHHHccHHccccEEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEcccEEEEEcccEEEEEEcccccccHHHHccccccccEEEEEEccccHHHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHcccEEEEccEEEEEccccccccEEEHHccccccHHHHHHHHHHHHHccccccccEEEEEEEEEEEEccccEEEEEEEEEEEEEEcccccccccccEEEEEccccccHHHccHHHHHcccHHHHHHHHHHHHHHHHHHcccc //