[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56751.1
DDBJ      :             had-superfamily hydrolase (subfamily IIIa) phosphatase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  214/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:175 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   49->131 2hszA PDBj 2e-06 36.6 %
:RPS:PDB   34->137 2cftA PDBj 1e-16 21.2 %
:RPS:SCOP  28->155 1u7oA  c.108.1.17 * 1e-16 17.3 %
:HMM:SCOP  1->151 1ydfA1 c.108.1.14 * 1.7e-24 22.8 %
:RPS:PFM   2->141 PF09419 * DUF2010 5e-19 38.6 %
:HMM:PFM   6->138 PF09419 * DUF2010 1.7e-13 29.8 131/168  
:BLT:SWISS 6->165 YQEG_BACSU 1e-32 35.0 %
:PROS 30->44|PS00678|WD_REPEATS_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56751.1 GT:GENE ACF56751.1 GT:PRODUCT had-superfamily hydrolase (subfamily IIIa) phosphatase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1602436..1602963) GB:FROM 1602436 GB:TO 1602963 GB:DIRECTION - GB:PRODUCT had-superfamily hydrolase (subfamily IIIa) phosphatase GB:NOTE identified by match to protein family HMM TIGR01662; match to protein family HMM TIGR01668 GB:PROTEIN_ID ACF56751.1 GB:DB_XREF GI:194358303 LENGTH 175 SQ:AASEQ MAIENYIPDFAVEAVYDLTVPSLQAQGIKAVLVDLDNTLIAWNNPDGTPEMKQWLHDLRDAGIGIIVVSNNTKKRVQRAVEKFGIDYVYWALKPFTFGIDRAMKEFHYDKKEVVMVGDQLMTDIRAAHRAGIRSILVKPLVQHDSIKTQINRTRERRVMRKITEKYGPITYKKGI GT:EXON 1|1-175:0| BL:SWS:NREP 1 BL:SWS:REP 6->165|YQEG_BACSU|1e-32|35.0|160/172| PROS 30->44|PS00678|WD_REPEATS_1|PDOC00574| BL:PDB:NREP 1 BL:PDB:REP 49->131|2hszA|2e-06|36.6|82/222| RP:PDB:NREP 1 RP:PDB:REP 34->137|2cftA|1e-16|21.2|104/292| RP:PFM:NREP 1 RP:PFM:REP 2->141|PF09419|5e-19|38.6|140/146|DUF2010| HM:PFM:NREP 1 HM:PFM:REP 6->138|PF09419|1.7e-13|29.8|131/168|DUF2010| RP:SCP:NREP 1 RP:SCP:REP 28->155|1u7oA|1e-16|17.3|127/162|c.108.1.17| HM:SCP:REP 1->151|1ydfA1|1.7e-24|22.8|149/0|c.108.1.14|1/1|HAD-like| OP:NHOMO 217 OP:NHOMOORG 214 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1111----------------------------------------------------------------11121111111111111111-2211111-11111-111111111-11111111111111111111111111111111111111111111111111111111111111111-11-111111111111111111111111111111111111111111111111111111111111111111------------1-------1-1--1111111111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111--------------1------111--11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 89.1 SQ:SECSTR ######ccHHHHHHHHHHHHHHHHTccEEEEEEcEEEEEEcccTTccHHHHHHHHHHHTcTTcEEEEcccccEEEcTTccEEEcHHHHHHHHTTcHHHHHHHHTTccccGGGEEEEEccTTTHHHHHHHHTcEEEEEcTEGTTccccEEEccHHH##HHHHHHH########### DISOP:02AL 1-1,170-170,173-176| PSIPRED ccHHHHcccEEccHHHcccHHHHHHccccEEEEEcccEEEccccccccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHcccccccccccccHHHHHHHHHHccccHHHEEEEEccHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHcccccccccc //