[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56752.1
DDBJ      :             conserved domain protein
Swiss-Prot:Y156_STRZJ   RecName: Full=UPF0356 protein SPJ_0156;

Homologs  Archaea  0/68 : Bacteria  75/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:77 amino acids
:PSIPRED
:RPS:PFM   2->77 PF07288 * DUF1447 6e-11 58.0 %
:HMM:PFM   2->77 PF07288 * DUF1447 1e-32 62.3 69/69  
:BLT:SWISS 1->77 Y156_STRZJ 3e-40 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56752.1 GT:GENE ACF56752.1 GT:PRODUCT conserved domain protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(131409..131642) GB:FROM 131409 GB:TO 131642 GB:DIRECTION - GB:PRODUCT conserved domain protein GB:NOTE identified by match to protein family HMM PF07288 GB:PROTEIN_ID ACF56752.1 GB:DB_XREF GI:194358304 LENGTH 77 SQ:AASEQ MIYKVFYQETKERSPRRETTRALYLDIDASSELEGRITARQLVEENRPEYNIEYIELLSDKLLDYEKETGAFEITEF GT:EXON 1|1-77:0| SW:ID Y156_STRZJ SW:DE RecName: Full=UPF0356 protein SPJ_0156; SW:GN OrderedLocusNames=SPJ_0156; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->77|Y156_STRZJ|3e-40|100.0|77/77| RP:PFM:NREP 1 RP:PFM:REP 2->77|PF07288|6e-11|58.0|69/69|DUF1447| HM:PFM:NREP 1 HM:PFM:REP 2->77|PF07288|1e-32|62.3|69/69|DUF1447| OP:NHOMO 75 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111----------------------1111111111111111111111-11111111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEEEccccccccccccEEEEEEcccccHHccHHHHHHHHHHccccccEEEEEEEccHHHHHHHHcccEEEEEc //