[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56753.1
DDBJ      :             DNA alkylation repair enzyme
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  78/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
a.118.1
:90 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->90 2b6cB PDBj 3e-19 57.7 %
:RPS:SCOP  4->90 2b6cA1  a.118.1.17 * 4e-26 48.2 %
:HMM:SCOP  4->90 2b6cA1 a.118.1.17 * 1.2e-22 40.0 %
:RPS:PFM   4->86 PF08713 * DNA_alkylation 2e-09 39.5 %
:HMM:PFM   4->90 PF08713 * DNA_alkylation 1.8e-34 44.8 87/213  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56753.1 GT:GENE ACF56753.1 GT:PRODUCT DNA alkylation repair enzyme GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 347969..348241 GB:FROM 347969 GB:TO 348241 GB:DIRECTION + GB:PRODUCT DNA alkylation repair enzyme GB:PROTEIN_ID ACF56753.1 GB:DB_XREF GI:194358305 LENGTH 90 SQ:AASEQ MSIKWSLSDNIWLRRVAINHQLLRKEKTNTQLMEKILLHNLNQTEFFINKAIGWTLRDYSKTNPTWVTCFIEKNKERMAELSIKEASKYL GT:EXON 1|1-90:0| BL:PDB:NREP 1 BL:PDB:REP 8->90|2b6cB|3e-19|57.7|78/211| RP:PFM:NREP 1 RP:PFM:REP 4->86|PF08713|2e-09|39.5|81/202|DNA_alkylation| HM:PFM:NREP 1 HM:PFM:REP 4->90|PF08713|1.8e-34|44.8|87/213|DNA_alkylation| RP:SCP:NREP 1 RP:SCP:REP 4->90|2b6cA1|4e-26|48.2|85/213|a.118.1.17| HM:SCP:REP 4->90|2b6cA1|1.2e-22|40.0|85/0|a.118.1.17|1/1|ARM repeat| OP:NHOMO 89 OP:NHOMOORG 86 OP:PATTERN -------------------------------------------------------------------- -------1111----------------------111-----1-1--------111--1-----------1----------------------------------------------------------------------------------------------------------------------------11111111-111111------111-------1111111---------------------11-1111-1-1------11----111111----111-1-11-1-111-------------111111---1-------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------1---------1-----------------------------------------1----------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------1------------------------------------------------------- ----11-----------------------------------------------------------------------------------------------------1--2----------------------------------------------------12--------12------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 96.7 SQ:SECSTR ###HHHTcccHHHHHHHHHTTTccGGGccHHHHHHHHHHTTTcccHHHHHHHHHHHHHHTTTcHHHHHHHHHHHHHcccHHHHHHHTTTc DISOP:02AL 1-2,90-91| PSIPRED cHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcc //