[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56761.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   21->102 PF10312 * Cactin_mid 6e-05 32.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56761.1 GT:GENE ACF56761.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(29872..30186) GB:FROM 29872 GB:TO 30186 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ACF56761.1 GB:DB_XREF GI:194358313 LENGTH 104 SQ:AASEQ MIAKKIFSNPEITCQFIRDMLDLPAKNVTILEGSDIHVLLSMPYSVQDFYTSIDVLAELDNGTQVIIEIQVHHQNFFINHLWAYLCSQVNQNLEKIRQREGDTH GT:EXON 1|1-104:0| RP:PFM:NREP 1 RP:PFM:REP 21->102|PF10312|6e-05|32.1|78/190|Cactin_mid| OP:NHOMO 22 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------32222221222--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,95-105| PSIPRED cccHHHHccHHHHHHHHHHHHccccccEEEEEcccEEEEEcccccHHHHHHHHHHHEEcccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHcccc //