[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ACF56764.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->54 PF01330 * RuvA_N 0.00028 37.9 29/61  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56764.1 GT:GENE ACF56764.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 420041..420235 GB:FROM 420041 GB:TO 420235 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE contains potential frameshift GB:PROTEIN_ID ACF56764.1 GB:DB_XREF GI:194358316 LENGTH 64 SQ:AASEQ MVIRVFDQQKNTYSSFALEELSYYMNRVFKTNIELVEEKEADIFVGLVNKEDSKRPCSYLIRQG GT:EXON 1|1-64:0| HM:PFM:NREP 1 HM:PFM:REP 26->54|PF01330|0.00028|37.9|29/61|RuvA_N| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-111-1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 7-7| PSIPRED cEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHEEccccEEEEEEccccccccHHHHHHcc //